KEGG   Toxoplasma gondii: TGME49_054560Help
Entry
TGME49_054560     CDS       T01093                                 

Definition
histone acetyltransferase, putative
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tgo  Toxoplasma gondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 447 aa AA seqDB search
MKGAPTGLGLASFFGKSFIFHTLHAALPALLEELANTVVGTELRRFVVALAAAVGLSSSH
AEELLHRAVAVRSSRLESILPSETGLGFLHRDAGGAREEELGIISFCCVTNDRQPLHMRH
LVTVKNIFSRQLPKMPREYIVRLVFDRAHFTFCLCKQGRVIGGVCFRPYFREKFAEIAFL
AVTSTEQVKGYGTRLMNHLKEHVKKSGIEYFLTYADNFAVGYFRKQGFSSKITMPRDRWL
GYIKDYDGGTLMECRLSTRINYLKLSQLLALQKLAVKRRIEQSAPSVVCPSLSFWKENPG
QLLMPSAIPGLAELNKNGELSLLLSSGRVGAAPQGSGALPGGRTGALGSKKGPFGRAGFA
KGEKGLRAASLKAQIAALLSTLEKHSSSWPFRRPVSGDYRTKEAFQEDLLLMFDNCRVYN
SPDTIYYKYADELQAFIWPKVEALGSF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcgctccaacaggtctggggctcgcgtctttcttcgggaagtcgttcattttt
cacacattgcatgcggcgttgcccgcgctgttggaggaactcgccaacaccgtcgtgggg
acggagctgcgacgcttcgttgtcgccctcgcagccgccgtcggcctctccagttcgcat
gcagaggagcttctccaccgggccgtcgctgttcgttccagtcgcctcgaatcgatcttg
ccgtcggagacaggcttggggtttctgcaccgcgacgcgggaggagcgcgcgaagaggaa
ctcggaatcatcagcttctgctgcgtgacgaacgacaggcaaccgttgcacatgcggcac
ttggtgacggtgaaaaacatcttctctcgacagctcccgaagatgccgcgagagtacatc
gtccggctcgtttttgaccgagcccacttcaccttctgtctctgcaagcaaggccgcgtc
atcggaggagtctgcttccgcccctacttccgcgaaaaattcgcggaaattgctttcctg
gcggtgacatctactgagcaggtcaagggttacgggacgcgtctcatgaatcatctcaag
gaacatgtgaagaaatctggaatcgaatatttcctcacctacgcagacaactttgcagtg
gggtatttccgtaagcagggcttcagcagcaagataacgatgccgcgagaccgttggttg
ggctacatcaaggactacgacggcggtacgttgatggagtgtcgtctcagcacccgaata
aattacctgaaactttcgcagctcctcgcgctacagaaactcgcagtgaagcgacgcatt
gagcaatccgcgccttcagtcgtctgtccttctctctctttctggaaggaaaatccaggt
cagctgttgatgccgtcggccattccgggcttggccgaactaaacaagaatggcgagctg
tctctgctgctgtcttcggggcgcgtcggggccgcgccccaagggtcaggggcccttccc
ggcgggcgcacgggcgccttgggctccaaaaagggccctttcgggcgcgcgggcttcgcg
aagggcgaaaagggcctgcgcgctgcgtcactcaaggcgcagattgcggcgcttctgtca
actctggaaaagcattcttcctcttggcccttccggcgacctgtctcgggggactacaga
acgaaggaggcgttccaggaagatctgctgctgatgttcgacaactgtcgcgtgtacaat
tcgcccgacacaatttactacaagtacgcagacgagctccaggccttcatctggcccaag
gtcgaggctctcgggagtttctga

DBGET integrated database retrieval system