KEGG   Toxoplasma gondii: TGME49_054640Help
Entry
TGME49_054640     CDS       T01093                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
tgo  Toxoplasma gondii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TGME49_054640
   00240 Pyrimidine metabolism
    TGME49_054640
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TGME49_054640
   03410 Base excision repair
    TGME49_054640
   03420 Nucleotide excision repair
    TGME49_054640
   03430 Mismatch repair
    TGME49_054640
   03440 Homologous recombination
    TGME49_054640
DNA repair and recombination proteins [BR:tgo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      TGME49_054640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 313 aa AA seqDB search
MAALSSAVYPDTNFCSDVTCIACTVAALQTVAGFDSRCRMSSRCGLQYSPCPDWKVSRWR
VPCCRTVSKLTLLVSFMPSFYSCALAKMNAEELRETPKKGRRGGPRRTSADREHGSGKSP
PSSKGVRSKTKHHTAPLRLPHSALCKGSYQIAKKCTTEGPFDTASSPEVRMAVAQPKRIC
SLRDTRDAAEQSRVFCGQNSHRTNPCNRFQGLSETLRHKLSLERQKTRHFVLGGDEGQAL
GTALEPMLQRFDMAVQYGPCCGLSRSERWYRADELGMKPPLEVKQAIQFTRGDASIFDQR
LSRFGVTNLEKHK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctgtcaagtgccgtttaccctgatacgaatttttgttcggatgttacgtgt
atcgcatgcactgtagctgccctccagacggttgctggttttgacagtcggtgccgcatg
tcgagccgctgtggtcttcaatactcaccttgtccagattggaaggtcagtcgatggcga
gtaccgtgttgtcgcacggtgtccaagctcaccttacttgtcagttttatgccatcattt
tattcgtgtgctttggccaaaatgaacgctgaagaattgcgcgaaacgccaaagaaaggc
cggagaggaggtccacgccggacgtcagctgaccgggagcatggtagcggcaaatcacca
ccatctagcaagggagttagaagcaaaaccaagcaccatacagctccgcttagactccct
cattcagcgctgtgtaaaggttcataccagattgccaagaaatgcaccactgaaggtcca
ttcgataccgcgtcatcgccggaggtgcggatggctgtcgcgcagccaaagcgtatttgc
tcacttcgagacaccagagacgcggctgaacaatcccgggtgttttgtggccagaacagt
catcgcactaatccttgtaatcggttccaaggattaagtgagacccttcgacacaagctt
agcctcgagcgtcagaagactcgtcactttgtcctaggcggtgatgaggggcaagcgctc
ggcacagcccttgagccaatgctacaaaggttcgacatggcagttcagtatggcccatgt
tgtggcctctccagatcggagcgttggtatcgagcagacgaattagggatgaaaccgcca
ctggaggtgaagcaggcgatacagttcacccgcggcgatgcgtctattttcgatcaacga
ttgtccaggtttggtgtcacaaatctggagaagcacaagtag

DBGET integrated database retrieval system