KEGG   Toxoplasma gondii: TGME49_059550Help
Entry
TGME49_059550     CDS       T01093                                 

Definition
hydroxymethyldihydropterin pyrophosphokinase-dihydropteroate synthase (EC:2.7.6.3 2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tgo  Toxoplasma gondii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TGME49_059550
Enzymes [BR:tgo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TGME49_059550
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TGME49_059550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 748 aa AA seqDB search
MGCWPPSFACLRLSWWNLPLFHKRSAFFFWPPPGLRLRPLPGGAIAHCASSRSFSFGLLQ
SKFSPFFTRFHQGTMTANSHFLQKMREEDPGKEYATAYIALGSNLQGDARLGIIEEAISE
LGRCLGPILGTSCLYETVPAFDVCPKGVVHDVFHPFYLNAVVKLRTPITDPWYVLEILKN
LEAKTGRPLPTPEDMEAALNDCTSSGEATNEDVPGQGNKGASRKGDWKEALKKDKYVRGA
PRLLDLDLLFFDKNGRSVVIHPDVRPVDKQWPLTLPHPRIITRNFVLFPLCDLDPEYIHP
VEGMSVKELLRINLERRRIHLLNAAEEARQTQELAAKTNSETSGDHIACSHRCAPAASLH
FVHNYRIDGSLAIPRRCFAATTEELWTLGGDAGIVDTLLYIEDVKTHADQIIKVGGEEAL
SEVQRTQLLRLQRLEKTLREEHPLKLMGILNVSPDSFTDHFSASVDEAVAAAEAMVTDGA
DVVDVGGEATNPFRVAGEVPLAVERERVVPVVQKILDKLGNRVIISVDTMKAEVARDAVT
AGADWVNDQTGESRKGGDGDPLSFVVGNSTTVVLMHKRGTPDTFDGYQDYDDVVHEVGSW
LASMSEALQRGGVGRWRILADPGLGISKNPEQSFELVRGVQRIKQMLPTGIPQLLGFSRK
RLVGWGVGESAQDRKGPPTTETVEGRRWGGAAIAAWCAANTDAVTVVRTHDVKDTRLVRD
VTERIQGVKSTINLMEKEPDMAPLYSFW
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctggccaccatcttttgcctgtttgcggctctcttggtggaatttgccgctg
tttcataaaaggtctgcgttttttttctggcctccgcctgggctgcgtcttcgccctctg
cctggaggagcaattgcacactgtgcgagctcgcgttctttttcctttggccttctgcag
tcaaaattttcccctttcttcaccagattccaccaaggaacaatgacggcaaattcacat
ttcctgcagaagatgagggaagaagaccctggcaaagaatacgcgacagcatacattgca
ttgggatccaacttgcagggggatgctcgactaggcatcattgaagaagcgatatccgag
ttggggcggtgtctaggacccattctgggcacatcgtgcctgtacgaaaccgttccagcc
ttcgacgtttgtccgaaaggcgtcgtgcacgacgtcttccatcccttttacctgaatgcc
gtcgtgaaactccgcacccccattacggatccctggtacgtgttggaaattcttaaaaat
ctagaggcgaaaacggggcgcccactgccaactcctgaagacatggaggcggcgctgaac
gactgcacctcctccggagaggctaccaatgaggacgtgcctgggcaagggaacaaggga
gcttcgcggaagggcgactggaaagaagcgctcaaaaaagacaagtacgtccgcggtgct
ccccggctccttgaccttgatttgcttttctttgacaagaacggaagatccgttgttata
caccctgatgtgcgtcccgtcgacaaacagtggcctctgacactgccgcatccgcgaatt
atcacgcgaaatttcgtcctgttccctctgtgcgacctcgatccggagtacatacacccc
gtggagggaatgtctgtgaaggagctgcttcgcatcaacctggagcggcgccgcattcat
ttgctgaatgccgcggaagaagcccggcaaacacaagaattggcggcaaagacgaatagc
gagacctccggtgaccacatcgcgtgctcgcaccgttgcgcaccggcggcatcccttcac
tttgtgcacaactacagaattgacggttcgctggccattccgcggcggtgtttcgcagcg
acgactgaagagctctggactcttggtggcgacgccggcatcgtagataccctcttgtac
attgaagatgtcaagacacacgcggatcagataatcaaggttggtggcgaggaagcgctg
tcggaggtgcagcggacgcagctgctccgtctgcaacgcctggagaagaccctgcgtgag
gaacatccgctgaagctcatggggattctgaacgtcagtccagactcgttcaccgatcac
ttttctgcgagcgtcgacgaggctgttgccgctgcagaggccatggtaactgacggcgca
gacgtggtcgacgtcggaggcgaggccacgaaccctttcagggtggccggcgaagttccg
cttgcagtcgaaagggaacgggttgttcccgttgtgcaaaagatcttggacaaactcggc
aaccgcgtcatcatttccgttgacaccatgaaggccgaagtcgcgagagatgctgtcacc
gccggagcggactgggtgaacgaccagaccggagagagcaggaagggaggggacggagac
ccgctttccttcgttgttggcaactcgaccaccgtcgtgctgatgcacaaacgcggcact
cccgacacgtttgacggttatcaagactacgacgacgtggtacacgaggtcggttcgtgg
ttggccagcatgagcgaggctcttcagcgaggcggcgtcggcaggtggcggattctcgcg
gatcccggcttgggaatctccaagaatcctgagcagagcttcgagctggtacggggcgtt
cagcgcatcaagcagatgttgccgacaggcattccccagcttctcggcttctccagaaaa
agattggtcgggtggggtgtcggtgaatccgcgcaagataggaaaggtcccccgacgact
gaaaccgtcgaaggtcgtcgatggggaggagcagcaattgctgcctggtgtgctgcaaac
acagacgcggtgaccgtcgtccggacgcatgacgtgaaggacactcggctcgtccgcgac
gtgactgagaggattcaaggagtgaaaagcacgattaacctgatggagaaagagccagat
atggctccgttatacagcttttggtga

DBGET integrated database retrieval system