KEGG   Toxoplasma gondii: TGME49_059550Help
Entry
TGME49_059550     CDS       T01093                                 

Definition
hydroxymethyldihydropterin pyrophosphokinase-dihydropteroate synthase (EC:2.7.6.3 2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tgo  Toxoplasma gondii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tgo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 748 aa AA seqDB search
MGCWPPSFACLRLSWWNLPLFHKRSAFFFWPPPGLRLRPLPGGAIAHCASSRSFSFGLLQ
SKFSPFFTRFHQGTMTANSHFLQKMREEDPGKEYATAYIALGSNLQGDARLGIIEEAISE
LGRCLGPILGTSCLYETVPAFDVCPKGVVHDVFHPFYLNAVVKLRTPITDPWYVLEILKN
LEAKTGRPLPTPEDMEAALNDCTSSGEATNEDVPGQGNKGASRKGDWKEALKKDKYVRGA
PRLLDLDLLFFDKNGRSVVIHPDVRPVDKQWPLTLPHPRIITRNFVLFPLCDLDPEYIHP
VEGMSVKELLRINLERRRIHLLNAAEEARQTQELAAKTNSETSGDHIACSHRCAPAASLH
FVHNYRIDGSLAIPRRCFAATTEELWTLGGDAGIVDTLLYIEDVKTHADQIIKVGGEEAL
SEVQRTQLLRLQRLEKTLREEHPLKLMGILNVSPDSFTDHFSASVDEAVAAAEAMVTDGA
DVVDVGGEATNPFRVAGEVPLAVERERVVPVVQKILDKLGNRVIISVDTMKAEVARDAVT
AGADWVNDQTGESRKGGDGDPLSFVVGNSTTVVLMHKRGTPDTFDGYQDYDDVVHEVGSW
LASMSEALQRGGVGRWRILADPGLGISKNPEQSFELVRGVQRIKQMLPTGIPQLLGFSRK
RLVGWGVGESAQDRKGPPTTETVEGRRWGGAAIAAWCAANTDAVTVVRTHDVKDTRLVRD
VTERIQGVKSTINLMEKEPDMAPLYSFW
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctggccaccatcttttgcctgtttgcggctctcttggtggaatttgccgctg
tttcataaaaggtctgcgttttttttctggcctccgcctgggctgcgtcttcgccctctg
cctggaggagcaattgcacactgtgcgagctcgcgttctttttcctttggccttctgcag
tcaaaattttcccctttcttcaccagattccaccaaggaacaatgacggcaaattcacat
ttcctgcagaagatgagggaagaagaccctggcaaagaatacgcgacagcatacattgca
ttgggatccaacttgcagggggatgctcgactaggcatcattgaagaagcgatatccgag
ttggggcggtgtctaggacccattctgggcacatcgtgcctgtacgaaaccgttccagcc
ttcgacgtttgtccgaaaggcgtcgtgcacgacgtcttccatcccttttacctgaatgcc
gtcgtgaaactccgcacccccattacggatccctggtacgtgttggaaattcttaaaaat
ctagaggcgaaaacggggcgcccactgccaactcctgaagacatggaggcggcgctgaac
gactgcacctcctccggagaggctaccaatgaggacgtgcctgggcaagggaacaaggga
gcttcgcggaagggcgactggaaagaagcgctcaaaaaagacaagtacgtccgcggtgct
ccccggctccttgaccttgatttgcttttctttgacaagaacggaagatccgttgttata
caccctgatgtgcgtcccgtcgacaaacagtggcctctgacactgccgcatccgcgaatt
atcacgcgaaatttcgtcctgttccctctgtgcgacctcgatccggagtacatacacccc
gtggagggaatgtctgtgaaggagctgcttcgcatcaacctggagcggcgccgcattcat
ttgctgaatgccgcggaagaagcccggcaaacacaagaattggcggcaaagacgaatagc
gagacctccggtgaccacatcgcgtgctcgcaccgttgcgcaccggcggcatcccttcac
tttgtgcacaactacagaattgacggttcgctggccattccgcggcggtgtttcgcagcg
acgactgaagagctctggactcttggtggcgacgccggcatcgtagataccctcttgtac
attgaagatgtcaagacacacgcggatcagataatcaaggttggtggcgaggaagcgctg
tcggaggtgcagcggacgcagctgctccgtctgcaacgcctggagaagaccctgcgtgag
gaacatccgctgaagctcatggggattctgaacgtcagtccagactcgttcaccgatcac
ttttctgcgagcgtcgacgaggctgttgccgctgcagaggccatggtaactgacggcgca
gacgtggtcgacgtcggaggcgaggccacgaaccctttcagggtggccggcgaagttccg
cttgcagtcgaaagggaacgggttgttcccgttgtgcaaaagatcttggacaaactcggc
aaccgcgtcatcatttccgttgacaccatgaaggccgaagtcgcgagagatgctgtcacc
gccggagcggactgggtgaacgaccagaccggagagagcaggaagggaggggacggagac
ccgctttccttcgttgttggcaactcgaccaccgtcgtgctgatgcacaaacgcggcact
cccgacacgtttgacggttatcaagactacgacgacgtggtacacgaggtcggttcgtgg
ttggccagcatgagcgaggctcttcagcgaggcggcgtcggcaggtggcggattctcgcg
gatcccggcttgggaatctccaagaatcctgagcagagcttcgagctggtacggggcgtt
cagcgcatcaagcagatgttgccgacaggcattccccagcttctcggcttctccagaaaa
agattggtcgggtggggtgtcggtgaatccgcgcaagataggaaaggtcccccgacgact
gaaaccgtcgaaggtcgtcgatggggaggagcagcaattgctgcctggtgtgctgcaaac
acagacgcggtgaccgtcgtccggacgcatgacgtgaaggacactcggctcgtccgcgac
gtgactgagaggattcaaggagtgaaaagcacgattaacctgatggagaaagagccagat
atggctccgttatacagcttttggtga

DBGET integrated database retrieval system