KEGG   Toxoplasma gondii: TGME49_062910Help
Entry
TGME49_062910     CDS       T01093                                 

Definition
NADH-cytochrome B5 reductase, putative (EC:1.7.1.1)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tgo  Toxoplasma gondii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tgo00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 339 aa AA seqDB search
MQGSAAEADRGAAFGSLFPPRPEPSLLLSVVAAVTVLVCALHWMLKNRASGKSFFLWSAE
LATPFLDKSRKKLVLVDKITISPNTFKFRFRLECPSQSLGLPVGKHLKLFAPAPKGTVPG
HWNKVPDTEADLVEIERKYTPITGDEVKGYVDLVIKVYRKGELAQFPDGGKMSQYLDSLH
PGDQVDVMGPFGLIEYLGNGEFQVNRRVLKKKHIGMVAGGTGVTPMFQLLSSILRTGGDK
TTVSLLFANRTEEDILLRDELEEMREQYPDQFECAFTVDVPSPTWRYFSGFVNEEMLKKV
MPPPSSDTAILLCGAPPMVRSCSEQLAKLGYAKEDVLEF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggtcagcagccgaagcagaccgtggggcagcctttggaagcctcttccctccg
aggccagagccttcgttgctcctcagcgtcgtcgctgccgtcactgtgttggtatgcgcc
ctgcactggatgctcaagaatcgcgcaagtggaaagtcgttttttttgtggagcgccgag
ttggcgactccgtttctggacaagtcgaggaagaagctggtgcttgttgacaaaatcacc
atctcccccaacaccttcaagtttcgcttccgcctcgagtgccccagccaatctctcggc
ctgcctgtgggaaaacatttgaaactcttcgcacctgcgcccaagggaactgtgcctggt
cactggaacaaggtgccagacacagaggcggacctggtggagatcgaacgcaaatacaca
cccataacgggagatgaagtgaaaggctatgtggatcttgtgatcaaagtttatcggaaa
ggagaactcgcgcagttcccagatggcggaaagatgtcgcagtatctcgacagtcttcac
cctggagaccaagtcgatgtgatgggacctttcggcctcatcgagtacttggggaacggc
gaattccaggtgaaccggcgagtgctgaagaagaagcatattggcatggttgctggaggc
acgggcgtgacaccgatgtttcaacttttgtcgtcgattttgcggacaggaggagacaaa
acaaccgtctctcttctcttcgccaaccggaccgaagaagacattctcttgcgcgatgaa
ctggaagagatgcgcgagcagtaccctgaccagttcgagtgtgcgttcactgtggacgtt
ccttcgccgacgtggagatacttctcaggtttcgtcaacgaagaaatgctgaagaaagtc
atgcctccgccttcttctgatacggccattctcttgtgcggcgccccgccgatggttcgc
agctgctcagaacagcttgcgaagctcggctacgccaaagaggatgtcctcgagttctag

DBGET integrated database retrieval system