KEGG   Toxoplasma gondii: TGME49_062910Help
Entry
TGME49_062910     CDS       T01093                                 

Definition
NADH-cytochrome B5 reductase, putative (EC:1.7.1.1)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tgo  Toxoplasma gondii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TGME49_062910
Enzymes [BR:tgo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TGME49_062910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 339 aa AA seqDB search
MQGSAAEADRGAAFGSLFPPRPEPSLLLSVVAAVTVLVCALHWMLKNRASGKSFFLWSAE
LATPFLDKSRKKLVLVDKITISPNTFKFRFRLECPSQSLGLPVGKHLKLFAPAPKGTVPG
HWNKVPDTEADLVEIERKYTPITGDEVKGYVDLVIKVYRKGELAQFPDGGKMSQYLDSLH
PGDQVDVMGPFGLIEYLGNGEFQVNRRVLKKKHIGMVAGGTGVTPMFQLLSSILRTGGDK
TTVSLLFANRTEEDILLRDELEEMREQYPDQFECAFTVDVPSPTWRYFSGFVNEEMLKKV
MPPPSSDTAILLCGAPPMVRSCSEQLAKLGYAKEDVLEF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggtcagcagccgaagcagaccgtggggcagcctttggaagcctcttccctccg
aggccagagccttcgttgctcctcagcgtcgtcgctgccgtcactgtgttggtatgcgcc
ctgcactggatgctcaagaatcgcgcaagtggaaagtcgttttttttgtggagcgccgag
ttggcgactccgtttctggacaagtcgaggaagaagctggtgcttgttgacaaaatcacc
atctcccccaacaccttcaagtttcgcttccgcctcgagtgccccagccaatctctcggc
ctgcctgtgggaaaacatttgaaactcttcgcacctgcgcccaagggaactgtgcctggt
cactggaacaaggtgccagacacagaggcggacctggtggagatcgaacgcaaatacaca
cccataacgggagatgaagtgaaaggctatgtggatcttgtgatcaaagtttatcggaaa
ggagaactcgcgcagttcccagatggcggaaagatgtcgcagtatctcgacagtcttcac
cctggagaccaagtcgatgtgatgggacctttcggcctcatcgagtacttggggaacggc
gaattccaggtgaaccggcgagtgctgaagaagaagcatattggcatggttgctggaggc
acgggcgtgacaccgatgtttcaacttttgtcgtcgattttgcggacaggaggagacaaa
acaaccgtctctcttctcttcgccaaccggaccgaagaagacattctcttgcgcgatgaa
ctggaagagatgcgcgagcagtaccctgaccagttcgagtgtgcgttcactgtggacgtt
ccttcgccgacgtggagatacttctcaggtttcgtcaacgaagaaatgctgaagaaagtc
atgcctccgccttcttctgatacggccattctcttgtgcggcgccccgccgatggttcgc
agctgctcagaacagcttgcgaagctcggctacgccaaagaggatgtcctcgagttctag

DBGET integrated database retrieval system