KEGG   Toxoplasma gondii: TGME49_063420Help
Entry
TGME49_063420     CDS       T01093                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TGME49_063420
Peptidases [BR:tgo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TGME49_063420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1100 aa AA seqDB search
MDWQSAIMKKPCVTQEAARLIWGKFSEPMLIQSEDESWYVVDREFLDNLQLLASYGTSED
PESPGLSSQDLPLRIRNRPLLSAASRDRPRATKSTRLDDSVAFAQGELFEVVNEEFWRLL
MQHFEADIEVPRRVYRDGQRLKVETQPLLLGVYTPENPDSSDSAAFVLAGNLLFSHGDTV
EEARTKVLALVNNATWTVLVGFPEEKGATHLRRLCTDSPTASLSEADVDGDVAFFVCPSA
IAEARLALSKPCVHLPGETPRLNGHLDNGDSACVSDRPEKRRPLPLPWEPYARLSAGERS
PESPQFALADKEGEGEKHSGVRRFFPGPEGLPSSSFREVRGPENIDEMFASGGICGLSNL
GNTCFLNSAVQCLSKVLPLSYYFLSGKFVADINEENVMGTQGRLARAYHATLRDMWFGGE
SSLAPRDLKAAVGRVREEFLGYNQQDSQELIAFLLDGLHEDLNRIKKKPYYESKIEGGPE
KPDAQVAELSWQRHKEINDSVIVDLFQGQYRSRLECPACRKVSVTFDPFMYLSLPVPPEW
RHQVVFTLGVDPGRPEAFCFQRAFPGNLDYNTAKQVCVDTVARLVSDAAMQTLSVEEKEV
LRRNVLSNVQLKELSQLSADNVLMVAKNREDLAGVYFSDVNAKIFTAEDTVRFRFDRKPS
HIFAWLMPSRIVQELEAGSGKDSARDGPEAAVDEYSSEPTAKGECARGSAGHTSDSAETK
TPPMTAAGDGDTSEDRWKTDSHTSGDSEKPSPEAACHRIKKRRSNSACLGARGLAETDTT
FALVLPVFRTPSGDVRPIQRCMPVLLPVPTGTTCEELHKQVEAIYHDSSEEEKSSSRPEE
TQPREEEGSPQGQSLINHAVGFIRSFSGQSDLAETRQVKLLVPSGFCAQEAQKSVLSQGV
NLLANGIGGKASNQPRPLPVDNQLVSANVKPKTGDFVILLYADMGSFADSEKVGPAEGIR
MMGAVEVQPSTDISDCLRLFSEQERLDVENMWYCSSCKEHVQAYKKLDLWKMPKILILHL
KRFHNIGRFTRSKIGTKVTFPYKAGDYLDMTPYILPESLEMMHAKDQGLAPLYELVAVNV
HSGELGGGHYFAYAKLRGRW
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atggactggcagtcggcgataatgaagaagccatgcgtcacgcaggaggccgcaaggctg
atctggggaaagttttcagagcccatgttgattcagtccgaagacgaaagttggtacgtt
gtagatcgagagttcctcgacaatctgcagcttctcgcgagttacgggacgtctgaagat
ccagagagtccaggtctttcttctcaagatttgccgctaagaattcggaaccggcctctg
ctgagtgcggcaagcagagacagaccgcgagcgacgaagtccacgcgtctcgacgactct
gtcgcatttgcgcaaggagaactcttcgaagtggtaaacgaggagttctggcgcctgctg
atgcagcactttgaggcagatatcgaggtgcctcggcgagtgtatcgcgacggtcaacgt
ctcaaagtcgagacgcagcctctgctcttgggcgtctatacacccgagaatccggactct
tcagacagtgcagccttcgtcctcgctggcaatctcctcttttctcacggggacactgtt
gaagaagctcgcacaaaggtccttgcattggtgaacaacgcaacttggactgttttggtg
ggcttccccgaagagaagggcgccacccacctccggcggctgtgtacagacagtccaact
gcttctctctcagaagcagacgtcgacggggatgtcgccttcttcgtctgtccgtcggcg
atcgccgaagcgcgtcttgcactctcgaagccttgcgtgcatctcccaggggagactccg
cgcttgaacggccacctcgacaatggcgattctgcatgcgtttcagatcgcccggagaag
cgtcggccgctgcctcttccctgggagccttatgctcgtctgagtgcgggggagcggtct
ccagaatcgccgcagtttgcgctggcagacaaggaaggggagggcgagaagcactcgggg
gttcggagattcttcccggggccagaggggcttccaagctcgtctttccgcgaggtgcgt
ggaccggagaacatcgacgaaatgttcgcgtctggcggcatctgcggcttgtcgaacctg
gggaacacgtgcttcctgaactctgcagttcagtgtctctcgaaagttctcccgctgtcc
tactactttctgagtggaaagttcgtcgcagacataaacgaagagaacgtcatgggcaca
cagggccgcctcgccagggcctaccacgcgacgctgcgggacatgtggttcggaggtgaa
tcgtcgctcgctcctcgggatttgaaggcggcagtgggacgtgtgagggaggaatttctg
ggctacaaccaacaagactcccaggagttaattgcttttcttctcgatggtctccacgaa
gaccttaatcgcatcaagaagaaaccgtactacgagtcgaaaatcgagggcggcccggag
aagccagacgcgcaagtggctgagctctcatggcagcgccacaaagaaatcaacgactcg
gtgattgtcgacttgtttcagggccagtaccgctcgcgcctcgagtgccctgcatgcaga
aaagtttctgtcacgtttgacccgttcatgtacctctctctccctgtgcctcccgaatgg
agacaccaggtcgtcttcactctcggcgtcgaccccgggcgtccagaagccttctgcttt
cagcgcgccttccccggaaacctcgactacaacaccgcgaagcaagtctgcgtggacact
gtcgctcgtcttgtctcagatgcagcgatgcagactctcagcgtcgaggagaaagaagtc
ttgcgacggaacgtcttgtcaaacgtccagctgaaggaactttcgcagctgagcgcggac
aacgtcctcatggtcgcgaaaaacagagaagaccttgcaggagtgtatttctcggatgtg
aacgccaagatctttacagcagaggacactgtgaggttcaggttcgaccgaaagccgtcg
cacatctttgcgtggctgatgccctctcggatcgttcaggaacttgaggccggctccgga
aaggactctgcgagggacgggccagaggctgctgtcgatgagtattcttcggagccgaca
gcgaaaggcgagtgcgcccgaggatctgcaggacacacgagcgactctgcggagacgaag
acgcctccaatgactgccgccggggacggcgacacaagtgaagaccggtggaagacagac
agtcacacgtcaggtgacagcgagaagccgtccccagaagcagcttgtcaccgcatcaag
aagagaaggtccaacagcgcctgcctcggcgcgagaggcctcgccgagaccgacacaact
ttcgccctcgtcctccccgtcttcagaaccccttctggagacgttaggccaatccagcgg
tgtatgccagtgttgttgcctgtcccgacgggcaccacatgcgaggagcttcacaagcaa
gtggaggccatctaccacgacagcagtgaagaagagaagtccagctcgcggccggaagag
actcagccacgtgaagaagaaggcagcccgcagggacagtccctgatcaatcacgctgtt
ggattcattcggagcttctcggggcagtcggacctagccgaaactcggcaggtcaagctc
ttggtgccttcagggttttgcgcgcaggaagcacagaagagcgttctcagccagggcgtg
aatttgctggcgaacggtattggagggaaggcgagtaaccagccgcggcctctcccagtc
gacaaccaacttgtgtcggcgaacgtgaaacccaagacgggagactttgttattctactc
tatgccgacatgggatcgttcgcagacagcgaaaaggtgggacccgcagaaggcattagg
atgatgggagctgtggaggtgcagccaagtacggacatctccgattgcctgcgtctcttc
tcggagcaagaacgactggacgttgaaaacatgtggtactgcagctcgtgcaaagagcat
gtccaggcctacaagaagctggacctttggaaaatgcccaagattttgattcttcatctg
aagcgttttcacaacatcggtcgatttacgcgatctaaaatcggcactaaagtcacattt
ccctacaaagccggtgactacctggacatgactccgtacattctccctgagagcctggaa
atgatgcacgcaaaggatcaagggctggctcccctttacgagctggtggcggtgaatgtt
cactctggggagcttggcggaggccactacttcgcgtacgcaaagctccgaggaagatgg
tga

DBGET integrated database retrieval system