KEGG   Toxoplasma gondii: TGME49_065010Help
Entry
TGME49_065010     CDS       T01093                                 

Definition
glutamate 5-kinase, putative (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tgo  Toxoplasma gondii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TGME49_065010
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TGME49_065010
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TGME49_065010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 867 aa AA seqDB search
MKREADAHSARATHGESHELPAERAAERSEKNRPEAEREERTADKSAMQGDNREEGKAEP
SEKGDASPLLLPAGKEVKPGCLVVVKIGTSTLLTATQDRMNMNLSNLGKFVDTICELRMR
GHTVVVVSSGAVGAGCVTLRLKQRPENLNTKQALAAVGQCRLMRLYEDLFSVREEKVAQV
LLSRHDLLHQKSYQNFQAALKALLALDVIPIINENDSLATEQLRFGDNDTLAAHIAVAVD
AHWLFILTDVDCLFDRNPHKYPDARPVAFVNRLTDVYAFLSDGACGAWGTGGMYTKVIAS
KIATNVGVHVAISNGKYPERILDMLEYARRSETTPTCPDTGSLLSLFPLRSPVREKHDHR
RGCCRREATQGEATQGEATQGEAIQGEAIQGEATQGEATQGEAIQGEAIQGEATQGEATG
GEATRGEATREVEEAKKKKEKKLARSCREAEKGAQRQRRAGGRGDGRAATGAPEAGERAR
DERAKSGGGQEEGEEISGKNLQEGEEREKRGNTDRANEWVHGAHASAEPGEVWGEEDRNP
VLKEEESIEAGQKGQEQDEESPGENRAQGAFAGPRDGRGQPFSSLMICDNLQQMPFLGTV
FIANDRRLHRKGDTRGWILSLPVRGKIFIDPGAVAALVQQKKSLFAAGVHHVSGEFAAND
CVAIYITNFPRGSRRPSERPAGTKGSGPPGEQGSLTSGPSRRGQLPLERRNACASQSYGN
QQRECLSRSSDEEAAFGFSFSNWCKSAAGSEGPPGGQTPFRAMGGLSESTVFAASPCPIE
CLEIARCISNVSSSELKVIKGRKSGEFRDLLGYAVDEEVAHRQHIVFTFMNGHEALKSFC
LAKHAKFKLAGRTEPPFTQEADSRTGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgaggcagacgcgcacagtgcgcgagcgacacacggagagagccacgaactt
cctgcagagagggcagcagaaaggtctgagaagaacagacctgaggcagagagagaggag
cggacagctgacaaatccgcgatgcaaggcgacaacagagaagaagggaaggcggaacca
agcgagaaaggcgacgcgagtcctctcttgcttccggcaggaaaagaagtgaagcctggc
tgtctagtcgtcgttaaaatcggtacaagcaccctgttgacagctacacaagaccggatg
aacatgaacctctccaacctgggaaaatttgtcgatacaatctgcgagttgcgaatgcga
ggccataccgtggtggtggtgtcgagcggggctgtaggcgcaggctgcgtgactctgcgt
ttgaaacagcgaccagaaaatctgaacactaaacaggcgctcgcggccgtcgggcagtgc
cgactgatgcgtctctacgaagatttgttcagcgttcgagaagagaaagtcgctcaagta
ctcctttctcgacacgaccttcttcaccaaaaatcgtaccaaaatttccaggctgctcta
aaggctcttcttgctctcgatgtgattcccatcatcaatgagaacgacagtctggcgaca
gagcagctgagattcggagacaacgacactctcgctgctcacattgcagtggctgtggat
gctcactggcttttcattctcaccgacgtcgactgcctcttcgatcgaaatcctcacaaa
tacccagacgctcgccccgtggcatttgtgaatcgcctgaccgacgtgtacgcctttctc
tctgacggcgcctgtggagcttggggcaccggggggatgtacaccaaagtgattgccagc
aaaattgcgacgaacgtcggggtgcatgtggcgatctcgaacggcaagtacccggagcga
attctggacatgctcgagtacgcgcgaagaagtgagacgactccaacctgcccggacact
ggcagcctcctctcgctcttccctctgcggtcgcccgtccgagagaaacacgaccaccgt
cgcggctgctgtcgcagagaggcgacgcagggagaggcgacgcagggagaggcgacgcag
ggagaggcgatacagggagaggcgatacagggagaggcgacgcagggagaggcgacgcag
ggagaggcgatacagggagaggcgatacagggagaggcgacgcagggagaggcgacgggc
ggagaggcgacgcggggagaggcgacgcgggaagtcgaggaggcgaagaagaagaaggag
aagaagctcgcaagaagctgcagagaagcggagaaaggcgcgcagcggcagaggagggcg
ggaggaagaggcgacggccgagcggcaacaggtgccccggaagctggcgagcgcgcgcga
gacgaacgggcaaagtcggggggcggtcaagaagaaggcgaggaaatctcgggaaaaaac
cttcaagaaggagaggaacgagaaaaaaggggcaacacggaccgagcgaacgaatgggtg
cacggtgcgcatgcatctgctgaacctggagaggtttggggagaagaagaccgaaaccct
gtcttgaaggaagaagaaagcatcgaagccggccagaaaggacaggaacaagatgaagag
agtccaggggaaaacagggcccagggggcgtttgcaggcccccgcgacggacgaggacag
cctttctcctctctcatgatatgcgacaatcttcagcagatgccgtttctagggacagtt
ttcatcgcgaatgaccggcgcctgcatagaaaaggcgacacgcgtggatggattctgtcg
ttgccggttcgtggaaaaatcttcatcgatccaggcgcagttgctgctctcgtgcagcag
aagaagtcgctgtttgcagcaggtgtacaccacgtcagcggggagttcgcagcgaacgac
tgcgtggcgatttacatcacgaattttccgcgagggtccaggcgaccctcagagaggcct
gcaggcacgaagggcagcgggcctccgggtgagcagggaagcctgacgagcggtccgtcg
aggcgaggccagctcccgttggagcgtcgaaacgcctgtgctagccagagttatgggaac
cagcagcgagagtgtcttagcagaagcagtgacgaggaagctgccttcgggttctctttc
tcgaattggtgcaagtcggcggctgggagcgaagggccgccagggggtcagacaccgttc
agggccatggggggtctgtcggagtcgactgtgttcgcggcgtccccgtgtccgattgag
tgcctggaaatcgcccggtgtatctccaacgtgagcagctctgaactcaaggtcataaaa
gggaggaaaagcggcgaattccgggacttactcgggtacgccgttgacgaagaagttgcg
cacagacaacacatcgtcttcaccttcatgaacgggcacgaagccttgaaaagtttctgt
ctcgcgaaacacgcaaagttcaaactcgcgggaaggacagagccgcccttcacacaagaa
gccgacagccggaccggggaataa

DBGET integrated database retrieval system