KEGG   Toxoplasma gondii: TGME49_066120Help
Entry
TGME49_066120     CDS       T01093                                 

Definition
glutathione/thioredoxin peroxidase, putative (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tgo  Toxoplasma gondii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:tgo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:tgo00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 333 aa AA seqDB search
MLPLCASSQMYLGQECLSCPVLPRLCLATCLGALYGRAFWRTNKRTAGHGKKWLGAHGKE
KFHCFSGSFFLAKTLTSAKSFFGRFSSLVPPSVFTTPRKQSAFRFSHLIPTRSPLSAQYP
GLKFLSSFSFLRMGIGGSRAAFAPDQIPVSFSTITFNDIYGVQRSLGEWDGKVKIVVNVA
SNCGLTKAHNKEFIELREKIGTDAFEILAFPSRQFANQEFADIAETQQFCERVKIPFPVF
TTSDVNGPETNPVFLYCKWNSDSFYHPVKNSKSAKLSDIGWNYGKFLVDKDNGVYKYYGP
RTKPLEMEEDIRKLIAGQAKGMKRNAAGELKPL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctctctgcgcgtcttctcagatgtatctcggacaggagtgcctgtcttgccca
gtgctgccgcgtctttgcttggctacatgtttgggggcgttgtacggtcgcgctttttgg
cggacaaataaacggactgctggtcacggcaaaaagtggctcggcgcgcatggaaaagag
aaattccactgcttctccgggtcgtttttccttgcaaaaacactgacttccgcgaagtct
ttcttcggccggttttcctccttggttcccccttctgtgtttacgactccgcgaaagcaa
tctgcatttcgtttcagccacctgattcccacacgcagcccactttcagcgcagtaccca
ggcctcaagttcctctccagcttttcttttctcaggatggggatcggcggcagcagagct
gctttcgcgccggaccaaattccggtctcgttcagcaccattactttcaacgacatatac
ggcgttcagcgctccctcggcgaatgggatggaaaagtgaagatcgtggtaaacgtcgcg
tccaactgcggtctgacgaaggcccacaacaaggagttcatcgagctgagagaaaaaatt
ggtaccgatgccttcgagattttggcttttccttcccgccagttcgccaaccaggagttc
gcagacatcgcggagactcagcagttctgcgagcgcgtcaagatccctttccctgtcttc
acgacttctgacgttaacggcccagagacgaaccccgtttttctctattgcaaatggaac
agcgacagtttctaccatcccgtgaagaacagcaagagcgcaaaactcagtgacattggc
tggaactatggcaagtttctcgtagacaaagacaacggcgtgtacaagtactacggcccg
aggacgaaaccgcttgagatggaagaagacatcaggaaactcatcgcgggtcaagcgaag
ggcatgaaacgcaatgcggcaggcgagctgaagcctctctga

DBGET integrated database retrieval system