KEGG   Toxoplasma gondii: TGME49_066120Help
Entry
TGME49_066120     CDS       T01093                                 

Definition
glutathione/thioredoxin peroxidase, putative (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tgo  Toxoplasma gondii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TGME49_066120
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TGME49_066120
Enzymes [BR:tgo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TGME49_066120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 333 aa AA seqDB search
MLPLCASSQMYLGQECLSCPVLPRLCLATCLGALYGRAFWRTNKRTAGHGKKWLGAHGKE
KFHCFSGSFFLAKTLTSAKSFFGRFSSLVPPSVFTTPRKQSAFRFSHLIPTRSPLSAQYP
GLKFLSSFSFLRMGIGGSRAAFAPDQIPVSFSTITFNDIYGVQRSLGEWDGKVKIVVNVA
SNCGLTKAHNKEFIELREKIGTDAFEILAFPSRQFANQEFADIAETQQFCERVKIPFPVF
TTSDVNGPETNPVFLYCKWNSDSFYHPVKNSKSAKLSDIGWNYGKFLVDKDNGVYKYYGP
RTKPLEMEEDIRKLIAGQAKGMKRNAAGELKPL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctctctgcgcgtcttctcagatgtatctcggacaggagtgcctgtcttgccca
gtgctgccgcgtctttgcttggctacatgtttgggggcgttgtacggtcgcgctttttgg
cggacaaataaacggactgctggtcacggcaaaaagtggctcggcgcgcatggaaaagag
aaattccactgcttctccgggtcgtttttccttgcaaaaacactgacttccgcgaagtct
ttcttcggccggttttcctccttggttcccccttctgtgtttacgactccgcgaaagcaa
tctgcatttcgtttcagccacctgattcccacacgcagcccactttcagcgcagtaccca
ggcctcaagttcctctccagcttttcttttctcaggatggggatcggcggcagcagagct
gctttcgcgccggaccaaattccggtctcgttcagcaccattactttcaacgacatatac
ggcgttcagcgctccctcggcgaatgggatggaaaagtgaagatcgtggtaaacgtcgcg
tccaactgcggtctgacgaaggcccacaacaaggagttcatcgagctgagagaaaaaatt
ggtaccgatgccttcgagattttggcttttccttcccgccagttcgccaaccaggagttc
gcagacatcgcggagactcagcagttctgcgagcgcgtcaagatccctttccctgtcttc
acgacttctgacgttaacggcccagagacgaaccccgtttttctctattgcaaatggaac
agcgacagtttctaccatcccgtgaagaacagcaagagcgcaaaactcagtgacattggc
tggaactatggcaagtttctcgtagacaaagacaacggcgtgtacaagtactacggcccg
aggacgaaaccgcttgagatggaagaagacatcaggaaactcatcgcgggtcaagcgaag
ggcatgaaacgcaatgcggcaggcgagctgaagcctctctga

DBGET integrated database retrieval system