KEGG   Toxoplasma gondii: TGME49_068860Help
Entry
TGME49_068860     CDS       T01093                                 

Definition
enolase 1 (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
tgo  Toxoplasma gondii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TGME49_068860
   01230 Biosynthesis of amino acids
    TGME49_068860
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGME49_068860
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TGME49_068860
Enzymes [BR:tgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     TGME49_068860
Exosome [BR:tgo04147]
 Exosomal proteins
  Proteins found in most exosomes
   TGME49_068860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 444 aa AA seqDB search
MVVIKDIVAREILDSRGNPTIEVDVSTEGGVFRAAVPSGASTGIYEALELRDKDPKRYLG
KGVLNAVEIVRQEIKPALLGKDPCDQKGIDMLMVEQLDGTKNEWGYSKSKLGANAILGVS
IACCRAGAASKGLPLYKYIATLAGKTIDKMVMPVPFFNVINGGEHAGNGLALQEFLIAPV
GAPNIREAIRYGSETYHHLKNVIKNKYGLDATNVGDEGGFAPNVATAEEALNLLVEAIKA
AGYEGKIKIAFDAAASEFYKQDEKKYDLDYKCKTKNASKHLTGEKLKEVYEGWLKKYPII
SVEDPFDQDDFASFSAFTKDVGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKVNQIG
SVTEAIEACLLAQKSGWGVQVSHRSGETEDSFIADLVVGLRCGQIKSGSPCRSERLCKYN
QLMRIEESLGADCVYAGESFRHPK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggttatcaaggacatcgttgcacgcgagattttggattctcgcggcaatcccaca
attgaagttgatgtatcaactgaaggaggtgtcttccgagctgcggttcctagtggagcg
tctacgggtatttatgaggctctggagttgcgcgataaagatccgaaacggtacttgggg
aaaggcgtgctgaacgctgtagagattgtccgacaggaaatcaagccagcattgctgggc
aaagatccgtgtgatcagaaaggtattgatatgcttatggtggagcagctggacggaaca
aaaaacgagtggggctattccaagtcaaagctaggtgcaaatgccattttgggcgtgtcg
atagcttgctgccgagcaggagcagcatcaaaaggcctaccactatacaaatacatcgct
acacttgcagggaaaacgatcgataagatggttatgcctgtaccgtttttcaatgttatc
aatggaggcgaacatgcaggcaatggcttggctcttcaagaattcctgatcgctcccgtt
ggtgctccgaacatccgagaggcaattcgttatggatcagaaacgtaccaccacctgaaa
aatgttataaagaacaagtatggcttggacgcgacgaatgttggcgatgagggcggcttt
gcaccgaacgtagccactgctgaagaggctctgaatctccttgttgaagccatcaaagct
gcggggtacgagggtaagatcaagatcgcatttgacgcagctgcttcagagttctacaaa
caagatgaaaaaaagtatgacctggattacaaatgtaagaccaagaatgcatccaaacac
ctgactggtgagaagctgaaggaggtttacgaggggtggctgaaaaagtatcccatcata
tcggttgaagaccctttcgaccaagatgacttcgcaagtttctcagcttttactaaggat
gtgggtgagaaaacacaggttataggggacgatattctggtaactaacattcttcgaatt
gagaaggcactcaaagacaaagcgtgcaattgcctgttactgaaggtaaaccagatcggc
tctgtaacagaggcaatcgaagcgtgcctccttgctcaaaaaagtggctggggggttcag
gtttcccatagatccggtgaaacagaggattcatttattgccgatcttgtcgtgggcctt
cgctgtggccagatcaagagtgggtctccttgcaggtccgagcgactatgtaaatacaac
cagcttatgcggattgaggagtccctaggagcggactgcgtatacgcgggagagagcttt
cgacacccaaaatga

DBGET integrated database retrieval system