KEGG   Toxoplasma gondii: TGME49_068860Help
Entry
TGME49_068860     CDS       T01093                                 

Definition
enolase 1 (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
tgo  Toxoplasma gondii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tgo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tgo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tgo00010]
Genetic Information Processing; Folding, sorting and degradation; RNA degradation [PATH:tgo03018]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 444 aa AA seqDB search
MVVIKDIVAREILDSRGNPTIEVDVSTEGGVFRAAVPSGASTGIYEALELRDKDPKRYLG
KGVLNAVEIVRQEIKPALLGKDPCDQKGIDMLMVEQLDGTKNEWGYSKSKLGANAILGVS
IACCRAGAASKGLPLYKYIATLAGKTIDKMVMPVPFFNVINGGEHAGNGLALQEFLIAPV
GAPNIREAIRYGSETYHHLKNVIKNKYGLDATNVGDEGGFAPNVATAEEALNLLVEAIKA
AGYEGKIKIAFDAAASEFYKQDEKKYDLDYKCKTKNASKHLTGEKLKEVYEGWLKKYPII
SVEDPFDQDDFASFSAFTKDVGEKTQVIGDDILVTNILRIEKALKDKACNCLLLKVNQIG
SVTEAIEACLLAQKSGWGVQVSHRSGETEDSFIADLVVGLRCGQIKSGSPCRSERLCKYN
QLMRIEESLGADCVYAGESFRHPK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtggttatcaaggacatcgttgcacgcgagattttggattctcgcggcaatcccaca
attgaagttgatgtatcaactgaaggaggtgtcttccgagctgcggttcctagtggagcg
tctacgggtatttatgaggctctggagttgcgcgataaagatccgaaacggtacttgggg
aaaggcgtgctgaacgctgtagagattgtccgacaggaaatcaagccagcattgctgggc
aaagatccgtgtgatcagaaaggtattgatatgcttatggtggagcagctggacggaaca
aaaaacgagtggggctattccaagtcaaagctaggtgcaaatgccattttgggcgtgtcg
atagcttgctgccgagcaggagcagcatcaaaaggcctaccactatacaaatacatcgct
acacttgcagggaaaacgatcgataagatggttatgcctgtaccgtttttcaatgttatc
aatggaggcgaacatgcaggcaatggcttggctcttcaagaattcctgatcgctcccgtt
ggtgctccgaacatccgagaggcaattcgttatggatcagaaacgtaccaccacctgaaa
aatgttataaagaacaagtatggcttggacgcgacgaatgttggcgatgagggcggcttt
gcaccgaacgtagccactgctgaagaggctctgaatctccttgttgaagccatcaaagct
gcggggtacgagggtaagatcaagatcgcatttgacgcagctgcttcagagttctacaaa
caagatgaaaaaaagtatgacctggattacaaatgtaagaccaagaatgcatccaaacac
ctgactggtgagaagctgaaggaggtttacgaggggtggctgaaaaagtatcccatcata
tcggttgaagaccctttcgaccaagatgacttcgcaagtttctcagcttttactaaggat
gtgggtgagaaaacacaggttataggggacgatattctggtaactaacattcttcgaatt
gagaaggcactcaaagacaaagcgtgcaattgcctgttactgaaggtaaaccagatcggc
tctgtaacagaggcaatcgaagcgtgcctccttgctcaaaaaagtggctggggggttcag
gtttcccatagatccggtgaaacagaggattcatttattgccgatcttgtcgtgggcctt
cgctgtggccagatcaagagtgggtctccttgcaggtccgagcgactatgtaaatacaac
cagcttatgcggattgaggagtccctaggagcggactgcgtatacgcgggagagagcttt
cgacacccaaaatga

DBGET integrated database retrieval system