KEGG   Toxoplasma gondii: TGME49_072350Help
Entry
TGME49_072350     CDS       T01093                                 

Definition
poly(A)+ RNA export protein, putative
Orthology
K14298  
mRNA export factor
Organism
tgo  Toxoplasma gondii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TGME49_072350
Messenger RNA biogenesis [BR:tgo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     TGME49_072350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MSFYGARTAASPAGGAVNNQMSYYNKASATNLPNGPRDTISQLGWSNEGSLLSCTSWDNT
VRVWQISAGFGSQIQAAAKVCMDAQAPLLCSTFGPSPNHLFVGCCDKTVKLYDLNASSST
PQVVAQHDQPVCSVAWNPIHNVIVTASWDGYVRMWDGKQQQPVWQQSVGGKIFRMGVHSP
FLVTCDNFRNVNVSNLNTLFTGNAPQQPTKIVPPLQKLQSRSMGLFPDKEHELPGVAVGS
VEGRVGICHFKQEHRNMNFSFKCHRQETRQGIQIYAVNTIDFHPKHGTFATGGADGSIVC
WDKVNRQKLRAFDNMGNSVTDVKFNPTGNNLLAYAVSYDWSKGPDQQELNKGHQVYVHMV
KDEDIRPRPKTTTRR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctatggagcacggacggccgcctcgcctgccggcggggctgtgaacaatcaa
atgagttactacaacaaagcgagtgcgacgaatctgccgaacggcccccgagacaccatt
tctcagctcggctggtcaaacgagggaagtctcctgagctgcaccagctgggataacacg
gttcgcgtctggcagatttctgcaggattcggcagtcaaattcaggcggcggcgaaagtc
tgcatggacgcccaggcgccactcctgtgctccaccttcgggcctagtccaaaccacctg
tttgtggggtgctgcgacaagacagtgaagctctacgatttgaacgccagttcgtcgact
ccccaggtcgttgcccagcacgaccagcccgtgtgcagtgtggcgtggaatccaattcac
aatgtcatagtcacagctagttgggacggctacgttcgcatgtgggatggcaagcagcag
cagcctgtctggcagcagagcgtcggagggaagattttccgcatgggcgtccatagccca
tttctagtgacctgcgacaacttccgcaacgtgaacgtctccaatctgaacactctgttc
acgggcaatgcgccgcagcaacccacgaagattgtccctcctctgcagaaactgcagtcc
agatccatgggcctcttccccgacaaagaacacgaacttcccggtgtggctgtcggaagc
gtggaaggacgcgtcggcatctgccatttcaaacaagaacacagaaacatgaatttcagc
ttcaagtgccacagacaagagacgcgacagggaattcagatctacgcggtcaacaccatc
gacttccaccctaaacatgggaccttcgcaactgggggcgctgacgggtcgattgtctgc
tgggacaaagtcaaccgccaaaaactgcgagcattcgacaacatgggcaacagcgtgacg
gatgtcaagtttaatccaacagggaacaatttgctggcgtatgcggtctcctacgattgg
tctaaggggccggatcaacaggaactcaacaagggccatcaggtgtatgtacacatggtg
aaggacgaagacattcgcccgcggcctaaaacgacaacccgccgataa

DBGET integrated database retrieval system