KEGG   Toxoplasma gondii: TGME49_083480Help
Entry
TGME49_083480     CDS       T01093                                 

Definition
dual-specificity tyrosine-phosphorylation-regulated kinase, putative (EC:2.7.12.1)
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TGME49_083480
Protein kinases [BR:tgo01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   TGME49_083480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 956 aa AA seqDB search
MDFQDLAETSKGDRCSEHSPPLQAGQVARVPSTQGRSSSSVLPVDDTFRNIQADAHQTQF
FPAAFPLVQAERSVSWNENSPSVKFDTRNLPQQSVARWKGFPSFSSSNCVRKLRVSCDTP
ALNSSEPSPAPGKRNEARADIQDEVATGMTETQRPPDYDQTHDPFMPVNGFRPLLRRTST
AQTKSAPLPEVPARASSFPDPRRDATEHVSTAVGCRLSSSSSTTAAMSNLLSSDSLSQMP
HTSCREVSGSDNESSSCEQGFMKGGQKDIVTLCRSRQQRGDAFRGSVISTVQWNISADSP
ETLVCRGRQTETEASSIRPAAPGVSLVASRQSDKGFTTSQQRIRHVSVTKSPKLMENNRF
SASPQQMFVRHLPCQSVPSILRLDSGAPRQQENALGEQNASPLGISETPPQSPCIRRSCS
AKAHTTHRVGFSRCERCVVGSEAQREQAFSYKAHPYCHYKKPCRENSKRTECVNSQETIQ
RQTGAPWPNLGVPGYSTSGVAADDTSRSLSQVAPDSWCVWKLNARTTGTNVHGNSKTFAV
HEEPDPHQCGTGYKQLPITGEELVRKHSDWLTEFEKTEALEFREVWYWGRSRKAPAGDSV
KAKDCHNNGFDDSRGDYLASLGDHVNYRFEMIAALGRGSFGQVFRAFDHKTGGCVALKIV
RNKKHFHVQGCVEVRTLQKLLQNDKDDKGNVIHMKEHFIFRNHLIITFELLNMNLYEFLK
RNTFKGLSSLAIRSIGIQLLQALRLLKRQQIVHCDLKPENIVLKNQLKSSIKVIDFGSSC
PEGEMPYSYIQSRFYRSPEVLLGLSYGCPIDIWSLGCILAELQTGHPLFAGENETDQVSC
IMEILGPPPLYIIAKSPRRRIFFDSNGDPKPYTNSHGKKRRVSSRDLSTVLQTDDVHFVD
FIRGKKLSWHTPTRGHGDLDPVQPYWNLWKKITSSQIRFNLFATGNFVSSRSTINR
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggattttcaagacttggctgagacttccaaaggcgaccgctgttcagaacattcaccc
cctctgcaagcgggacaggttgcccgcgtcccaagcactcagggcaggtcttcctcttct
gttctcccggttgatgacacctttagaaatattcaggcagacgcacatcagacacagttc
ttcccggccgcttttcccctggtgcaagctgagaggtccgtctcttggaatgaaaacagt
ccctctgttaagtttgacactagaaacctgccgcagcaatcggtggcccgctggaagggc
tttcccagtttctcgagctcgaattgtgtgcggaagcttcgtgtctcctgtgacacacct
gcgttgaatagttctgaaccttcacccgcacctggcaagagaaatgaggctagagctgat
attcaagacgaggtggctacaggcatgacagaaacacaacgtcctccggattacgatcag
actcatgacccatttatgccagtaaatggtttcagacccctcctccgtcgaacatccacg
gcgcagacaaagtctgccccgttgcctgaggtgcctgctagagcatcatctttcccggac
cctcgccgtgatgccaccgagcacgtaagcacagctgtcggatgcagactctcttcgtct
tcttcgacgacggccgcgatgtccaacctattatcatcagacagcctgagccagatgcca
cacaccagctgtcgtgaggtcagtgggagtgacaacgagtcatccagctgtgaacaaggc
tttatgaaaggtggtcagaaagacattgttacactgtgtcgatcaaggcagcagagagga
gatgcatttcgtggttctgtgatatccactgttcagtggaacatcagcgccgacagcccg
gaaacgttagtatgccggggaagacagaccgagacagaggcttctagcatcaggccagca
gctccgggggtgtccctagtagcaagccggcaaagcgataaaggatttaccacttcacag
caaaggatcagacacgtttcggttaccaagagtcctaaactcatggaaaacaacaggttc
tcggcgtcaccgcagcaaatgtttgtccggcatctaccatgccaatcggtgccgtctatc
cttcgccttgatagtggtgcgccgagacagcaggaaaacgccttgggagagcagaacgcc
agtcctcttggaatatccgagactccgccgcaatcaccttgtattcgacgcagctgtagt
gccaaagcgcacactactcaccgagtgggcttttccagatgcgagcgttgtgttgttgga
agcgaggcccagcgagagcaagcattttcatacaaggcgcacccttactgtcactataaa
aagccatgccgggaaaattcgaaaagaacagagtgcgtcaattcacaggagaccatacag
cgacaaacaggcgcaccttggcccaatctgggagtgcctggatactcaacctccggtgtt
gcagcagatgacacgagcagaagcttgtctcaagtggcaccggatagttggtgtgtatgg
aaactgaacgctaggacaactggaacaaacgtacacgggaacagcaaaacgtttgccgtc
cacgaggaaccagacccgcatcagtgtggaaccggatacaagcaactacccataaccgga
gaggagttagtacggaagcacagcgactggttgacagagttcgagaaaacagaagctctt
gagtttcgcgaggtgtggtactggggaaggtccaggaaagcacctgctggggactccgta
aaagcaaaggattgtcataacaacggcttcgatgacagtagaggtgactaccttgcaagt
ttgggagatcacgtgaactacaggttcgagatgattgcagccctcgggagaggctccttc
ggtcaagtttttagggcgttcgaccacaaaactgggggttgcgtggcactgaaaattgta
cggaacaagaaacatttccatgtccaagggtgcgtggaagtgcgtaccctgcaaaaattg
cttcaaaacgacaaggatgacaaaggcaacgtcatccatatgaaggagcatttcatattc
aggaatcacttgatcatcactttcgagttgctgaacatgaatttgtacgagtttctcaaa
cgaaatacgttcaaaggcttatcatcgctcgcgatacggagcatcggtatacagttgcta
caagctctgcgccttttgaagcggcaacagatagttcactgcgacttgaagccggaaaac
attgttctaaagaatcaactgaagtccagcataaaggttatcgattttggttcaagctgt
cccgagggagagatgccctattcctacatacagtcgagattctacagatctcccgaagtc
ctgctgggattgagttacggctgtcctattgatatatggtcgcttggatgcatcctggcc
gaactccaaactggacatcctcttttcgcgggggaaaacgaaacagatcaggtcagttgt
ataatggaaatattggggccgcctccgctgtacattattgctaaatctcctagacgacgt
attttttttgatagcaacggcgatccaaagccgtatacaaattcgcacgggaagaaaagg
cgagtgtcctcaagagacctttctactgtgcttcagacagacgacgttcatttcgtcgat
ttcatccgaggtaagaaattaagctggcacacaccgacacgcggacacggagatttggat
cctgtgcagccgtattggaatttgtggaagaaaatcaccagctcacaaatacggttcaac
ttgtttgcaaccgggaacttcgtttcttcaaggagcaccattaaccgctaa

DBGET integrated database retrieval system