KEGG   Toxoplasma gondii: TGME49_086470Help
Entry
TGME49_086470     CDS       T01093                                 

Definition
cAMP-dependent protein kinase catalytic subunit (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TGME49_086470
Protein kinases [BR:tgo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TGME49_086470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 514 aa AA seqDB search
MPLRTMSVTSGQYPVQPHQRRPLFGRGNLFFFLNSGSSDGAAVGTPGVSPSREQSGFQML
TKRSLFGVSHPPTHSSRTVAQMAPRSQAYTPQPHRSSGDCSTAEKASCPTGSAAVHQATN
MGSVSAVAGPLGRMWGKLSSMSTMATSRGDSLLSTSSRTSVAVECSPRATQPPPNVADRE
SQILSQVRYDLLARNLSIDDFLFHETVGTGSFGRVCIVDLRGAAGWYPPMALKILSKHKI
VKMKQVEHVKDEKRILSSIEHPFIVNLLAAFQDEKRLFILMEYVNGGELFSHLRRRNCIP
TDQARLYAAEITLAFQYLHQRHIVYRDLKPENLLIDSQGHIKITDFGFAKVVKDRTWTLC
GTHEYLAPESITRRGHGLPVDWWALGILLFEMLAGHPPFVDENPLGIYRKIIAGKIEFPR
SFDYAAKSLVKRLLTHDPLKRYGCLKDGAEDVKNHKFFKGIDWVKCYNKNIRAPYLPNTR
GPQDSSMFDKYAESTESSSPPIGAAEQQAFFDNF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgcgtacaatgtcggtgacatcggggcagtatccggtgcagccacatcaacga
agaccccttttcggtcgcggcaacctcttcttcttcttgaacagcggctcgtctgacggt
gcagcagttgggacaccaggagtttctccttcgcgggagcagtcgggtttccagatgctg
acgaaaaggagtctcttcggtgtgtctcatccaccaacccattcgagccgaactgtcgct
cagatggcgcctcgctcgcaagcatatacaccacagccgcaccggtctagtggggattgt
tcgacggcagaaaaggcttcttgtccaaccggcagcgctgccgtccatcaggcaacaaat
atggggtcggtctccgctgttgctggacctttggggagaatgtgggggaaactcagtagc
atgagcacgatggcgaccagtcggggcgatagtctgctgtcaacgagcagccggacatca
gttgcagttgagtgcagcccccgagcaacacaacctcctcccaacgtcgctgatcgggag
agccaaattctctcgcaagtgcggtacgatctacttgcgaggaacttgtcgatagacgat
tttttgttccacgaaaccgttggcactggctcttttggacgagtttgtatagtcgattta
cgtggtgcggccggatggtacccgccaatggcattgaagatcctgagcaaacacaagatc
gtaaagatgaaacaagtcgagcacgtgaaggacgagaagagaattctttcttcgatagaa
catcccttcatagttaatctgctggctgcgtttcaagatgaaaagcgattgttcattttg
atggagtacgtgaacggcggggagctattcagtcacttgcgccgccgcaactgtattccg
actgatcaggcccgtttgtatgctgccgagatcactctggcattccaatacctgcaccaa
cgtcatatcgtttatagggatctcaaacctgagaacctactgattgactcacaaggccac
ataaaaattaccgatttcggatttgccaaagtggtgaaggatcgcacgtggacattgtgt
ggaactcacgaataccttgccccagaatctatcactcgtcggggtcatgggctacctgtt
gattggtgggccctggggatcctcctctttgagatgcttgccggacatccgccattcgtc
gatgagaatccacttggtatttatcggaagatcatcgcaggtaaaatcgagtttcctaga
tcgttcgattacgcggccaaatctcttgtcaagcggttgctcacgcatgatccgctgaag
agatacggttgcttgaaagatggagcggaggacgtaaagaaccacaagtttttcaagggg
attgactgggtaaagtgctacaacaaaaacattcgcgccccatacttgccgaatactagg
ggcccacaggatagcagcatgttcgacaaatatgccgagtccactgaatcgtcttctccg
ccaataggtgcggcggaacagcaggccttcttcgacaatttttga

DBGET integrated database retrieval system