KEGG   Toxoplasma gondii: TGME49_088740Help
Entry
TGME49_088740     CDS       T01093                                 

Definition
asparaginase, putative (EC:3.1.1.47)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TGME49_088740
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     TGME49_088740
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     TGME49_088740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 703 aa AA seqDB search
MVLVPGAMSQKITASHASVQKHRRCLSRSTMNPAHSIEPSAESGGAQPSDSVLASGAGAA
SLSTPVLRACSSAPHLTESRLPGSLQLVNGRHERLPANFGSVSQRMTVNDHTVVCLSADI
TPLHLSAAVTDCGLDMQEIKSKRTNTQNSLDFEGAALHISPAAAPVVAPGADTSGDKQLH
HLSEATDAAVASFPANASEKPAGSAAASPSGGTTGPVSRFDGAVIKPVPGSDTGKVHAEA
DNSMHAPGSRAHLLGDPVALSAGTGVFAPATDPSVATAATLLSSSSPGTSGVTTTLLPQK
PLILIIITGGTICMDYGGELSSMRPTRLAQRLQDLPEMRDPNLPYFDVLEWDTLVDSSEI
GLPQWRLLAQQIHNFYGDYDGFVVLHGTDTMAYTAAALSFMLENLGKPVVMTGAMLPMMH
ISTDAKRNLAVSMMMAGYSQLTELVVIFGSRVLRGTRVSKVDCSRIDAFESPNFPALGCV
GVDVVLHDELLLKPPVRGFRIFTQFCLNVAVVPITPFLPVDRLKRVFEDPKRPLAVVLQL
YGSGTAPSTKELLDTIKAAIENGINIVATTQCRRGSANLLAYESGVWLSNLGVINGKDLT
LEACVAKLAYLMGKGYTGAPLKDLMESDIRGELTESPNKVSGVSNVLDVAEVQGDRSKSC
VRDEKREMFAQSPSQGGNEEKLVSQNLGACTLYRHRPRELAEA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgttcctggcgccatgtcccagaagatcaccgccagccatgcttctgttcag
aagcatcgtcggtgtctgtctcgttccacgatgaatcctgctcattctatcgagccttct
gcagagagcggcggcgcccagccgtctgactctgtgctggcttccggagctggcgccgcc
tccttgagcacccccgttttgcgtgcgtgctcatctgcgccgcatctcaccgagagtcgc
cttcctggtagtcttcagctggtgaacggtcgacacgagaggctgcccgccaattttggc
tcggtctcgcagcggatgactgtgaacgaccacacagtcgtgtgcctttctgcagacatc
accccgctgcacctgagcgctgctgtgaccgactgcgggctggacatgcaagaaattaag
tcgaaacgcaccaatacgcagaattcgctcgacttcgagggtgccgcgttgcacatctcg
ccggccgcagctcctgttgtggctccaggtgccgatacatccggcgacaagcagctgcac
catctgtcggaagcgaccgatgcagcagttgcctcgtttccggcgaacgcttctgaaaag
ccagcgggttcggctgcagcgagtccgtcaggtgggacgactggaccggtctcgcgtttt
gacggcgcggttataaagcccgtccccggcagcgacactggcaaggtgcacgcagaagcc
gataactcgatgcatgcgccgggaagccgcgctcacctgcttggcgacccggtcgccttg
tccgcgggcactggcgtctttgcgccggcgaccgatccgagtgtcgcgaccgccgcgacg
cttttgtcttcgtcgtctccggggacttcgggtgtgacgacgacgttgctcccgcagaag
ccgctgattctgatcattatcacgggcgggacgatctgcatggactacggcggcgagttg
tcttcgatgcggccgacacggctcgcgcagcgtctgcaggacttgcctgaaatgcgggat
ccgaacttgccgtacttcgacgtgctcgagtgggatacactggtcgacagcagcgaaatc
ggcctaccgcagtggcggctcctggcgcagcagatccacaatttttacggcgactatgac
ggcttcgtggttctccacgggacagacaccatggcatatacagccgccgcactctcgttc
atgctcgaaaacctgggaaagccagtggtgatgacgggtgcgatgctgccgatgatgcat
atctccacggacgcgaagcgaaacctcgcggtctctatgatgatggccggctactcgcaa
ctcaccgaactggtggtgatctttggctcccgcgtgctgcgcggcacccgcgttagcaaa
gtcgactgctcccggatcgacgccttcgagtcgccgaacttccctgcccttggatgcgtc
ggcgtcgacgtcgtcctccacgacgaactcctcctcaaaccacccgtccgcggattccgc
atcttcacccagttctgcctgaacgtcgccgtcgtccccatcacgccgttcctcccggtc
gaccgactgaagcgcgtgttcgaagatccgaaacgccccctcgccgtcgtcctccagctc
tacggctccggcaccgcgcccagcaccaaggaactcctcgacaccattaaggccgcgatc
gaaaacggaatcaacatcgtcgccacgacccagtgccgacgcggctcggccaacctcctc
gcctacgaaagcggcgtctggctttccaacctcggggtcatcaacgggaaggacttaacc
ctcgaagcgtgcgtcgccaaactcgcgtacctcatggggaaaggctacacaggggcgcca
ctgaaagacttgatggaatcggacatccgcggcgaactgacggagtcgccgaacaaagtc
agtggcgtgagcaacgtgctggatgtagccgaggtgcagggcgaccgatcaaagagctgc
gtccgggacgagaagcgcgagatgtttgcccagtccccgtcgcagggcggaaacgaagag
aagctcgtctctcagaacctaggagcatgcacactctaccggcaccggccgagagaactc
gccgaggcgtag

DBGET integrated database retrieval system