KEGG   Toxoplasma gondii: TGME49_089330Help
Entry
TGME49_089330     CDS       T01093                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:1.1.3.12 3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TGME49_089330
Peptidases [BR:tgo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TGME49_089330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2100 aa AA seqDB search
MSRRERKGANELNKSDPNCVPPSLLDSQLALLAANSFDVPLTLKKSTASLSASRSSSPRS
VVSANCSSPRTSDFPDRDPLASSVDLPRASPASPASPASPASPASVSPRSLGSRSPVSSS
FAGNLREREGVCLRGALHLSPSCGAALGSLSPPPLLRTSRSACLSPSVSTDPPRASPLGV
SFLSSTMEEDDAALFKVEKGSSRLAAKAPEAGATAGELGVCTPVPGVTPEPSGGVSPPVP
KAFGLASSTPRRLNDGSLLEAPLSNELEMVIPRFRARFLEGLEEGDAPVDSLTLYSDWKE
LPALRFRLMVHPLTRSHSRLAQLSPPSPLLPEARALSPQQQEFLQSRTAAAFVEIGPKPD
WPADWSFQAGVRFHIYVVNLSEPERSIWKEETFQFSCEEVDRGWHSIVSYWTLYEERFFA
SQSGDLVLRAAVFPAGTAVMSRGLRTPCPPSPPSGKGYVGLRNHGATCYMNALLQSLYYI
GKFRQAVYALTFDTKAISGPRSVQVLESSRFKSGGSGRDSDNASAYCSPAPHPLAALLVN
SDDEEEDFSDWNEQDMRDLLLEEEQEQRRPPSISLALQNLFFRLYTSEEPVACRDLIRSF
GWDAADAFTQQDTHELLKLLLDKVEEQMQGTPAEGSVKKMFEGEMETYIECIEVDYKSVR
KETYEDLNLDVKGCSTIQESLRRLVQPEILEGENSYDAEAFGKQRARKGVRFLRFPPVCI
FLLKRFDFDYEKMDTVKVFSSFEFQSELDLNEFCPGAGVYELHAVSVHQGDVNSGHYYCF
LRPPPRTQWVRFDDDKVYPVSEYAAIGDNFGGDEEDPCNYLAGEFRFFRLQSSRAPRSRQ
KVYNAYILVYVKKRLANQLLADCNPMKVNPQVVIRCRTEELLMKLRNRIRRVLEQRIKVK
VYHPLQFVNRRFLDLPLATMRPLLELKSSRSVGILPIHEQITARLFSKLYGEEGTGGEGG
ACSQRAGKASPPIAFLLYAMDFLADDARFSPLSLADNPCLGEIFRAKMVGNSGRAGGVLG
ARVYPGGASDLNYPYNRFDACLYFLAVPETNAVIREAVDHDEFCRRHQLLFLKYFDVFSA
NTVLVEASEPVAPQDPKGQRNRQEDDAPVCAALAKKVGEDPSDVPEALRDNNIICLDVVL
VPNGWKLVCLQPHLYRLLLRCMEDGLTRPFALESLRRYVSSLGSLPPLFAASSSGGSRLF
FPGAGEKRPLVDVATSQSCSLAACAAAYGAGLSATLCGPVFLSTQGNFPALSSSREQTPE
LPREPALVLALEIEFQDLKNPTSLTLSSKKTFSQEKATAVVDEKSRASVSPEEGTGVALW
PSSSSPASSSPPSATGAAAQALSTAARAALGDADPLGEKAEEKETLAAKADETASCSTAD
VSTTVASPMNSGALPPSRAAGLKPDAEAKAGDSLSGQARGSPDGENSKESSPVSLDLPSH
APGGSDGALLPYLSAARGGRIPSDPPEMPVLPSPDFHHYSLNKANRFVFQFRLYDPLELL
NRPMNCCGMLLEDYPRPSVGSSACLASRDLSLSHCSSNETLSSFTLSSTWSATSALTSDP
CLPVSATKGGNAPSVSASLVLPTASPSPVTPLAAAGPFGAPAGAATAVGGSGLQRAVSGA
GADLECADGDATADSEEDEDPWIHVPKGQPVVAKMLEVDVRVACNQVLRYVSWYMGVDPS
RLLLFPEPPLLSDASFAPVTIDSLVCAVSEGGVSRRDGSGGSSPQASLRRLSVNEVFSRL
EKKALLGAGSRLGRRRPRPAGSFAFAGPAGSRHRIFHLAVLPRHYSLCSRVVDPATLTPV
QLERAKELVFPVSLGTAAGGASAAALPPEAPLQDPLLHFVVLVFSRRVESLGCVEGLIPA
RCPFSSRPLTVKDLIHAILARMSPALRAQLVDERRRSASQEGRSISAETSGEHAAEKTAS
ADGARVSDAALAGSLRLLESSVASLHDLEKTQQIHSLALYAGQSGRRLDGPSTQNLFAVP
LRLELDWTPEEKESIENGELKVLQVVHQTPSDREYFGYPFEILVRPSDTLNEIKHKVKEK
LLLPKPLWSNWTFFQYADCNRSWKGPNDRLDWQRYDSITLIAEHPAPYSKMRLPTAMKIA
NT seq 6303 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcgcgagagaaagggggcaaatgagttgaacaaaagtgatcctaactgtgtc
cccccatctctactcgactctcagcttgcactgctcgctgctaactcgttcgacgttccc
cttactttgaaaaagtcgacggcctctctgtctgcctcgcgctcctcctcgcccagaagc
gtcgtgtctgccaactgcagttcgccccggacttccgacttcccggaccgtgaccctctc
gcgtcctctgtcgacttaccacgcgcttctccagcttctccagcttctccagcttctcct
gcttctcctgcttctgtctcgccccgctctctgggttctcgttctccagtctcttcgtct
ttcgctggcaacttgcgggagcgcgagggcgtgtgtctccgcggcgccttgcatctgtct
ccttcgtgcggcgccgcgctcggttcgctgtctccgccgccgctgctgaggacgagtcgc
tcagcttgtttgtctccgagtgtctccacagatccccctcgcgcgtctccgctgggagtc
tcttttctctcgagcacgatggaggaagacgacgcagcgctcttcaaggtcgagaagggg
agctcgcggctggccgcgaaggcgcctgaggcgggagcgactgcgggcgagttgggtgtc
tgtacacccgtcccaggggtcactcccgagccctcaggcggagtgtctcctccggtgccg
aaggctttcggactcgcgtcctcgacgccgcggcgcctgaacgacggctccttgctcgag
gcgcctctttcgaacgagctcgagatggtcattccacgtttccgcgcgcgcttcctcgaa
ggactggaagagggtgacgcgcccgtggactcgctcacgctctacagcgactggaaggag
cttcccgcacttcgcttccgcctgatggttcacccgctgacgcggtcgcacagccggctg
gcgcagctctctccgccgtctccgctgctcccggaggcgcgcgccctctctccccagcag
caggagttcctccagagtcgcacggcggcggccttcgtcgagatcggcccgaagccggac
tggcctgcggactggagcttccaagcgggcgtccgcttccacatctatgtggtgaatctg
tcggagccggagcgctcgatctggaaggaagaaacctttcagttcagctgcgaggaagtc
gaccgcggctggcactcgattgtctcctactggacgctgtacgaagagcgcttcttcgcc
tcgcagtctggagacctcgtcctgcgcgccgccgtcttccccgcaggcaccgccgtcatg
agtcgcggcctgcggaccccctgtcccccctcgccgccctctggcaaaggctacgtcggt
ctccgaaaccacggcgcaacgtgctatatgaacgcgctcctccagagcctctactacatc
gggaagttccgacaagcggtctacgccctcacgttcgatacgaaggccatcagcggtccg
cgaagcgtccaagtgctggagagcagtcgtttcaagtctggcggctctggacgagactcg
gacaacgcgtctgcgtactgttcgccagctccgcatccgctggcggcgctgctggtgaac
agcgacgacgaagaggaagacttctcggactggaacgagcaagacatgcgcgacttgctg
ctggaggaggaacaggagcagcgccggccgccctccatctcgctggccctgcagaacttg
ttcttccgtctgtacacctccgaggagcctgtagcatgtcgggacttgattcgctctttc
ggatgggatgcggccgacgcgttcacacagcaagacactcacgagttgctcaaactgctg
ctcgacaaagttgaggagcagatgcaggggacgcccgcagagggcagtgtgaagaagatg
tttgagggcgagatggagacgtacatcgagtgcatcgaggtcgactacaagagcgtgagg
aaggagacgtacgaagacctcaacctcgatgtgaagggatgcagcaccatccaggaaagt
ctgcgcagactcgtgcagccggaaattctcgaaggagaaaactcgtacgacgcagaggcg
ttcggcaaacagcgagcgcggaagggcgtccgcttcctccgctttccgccggtctgcatc
tttctcctcaaacgcttcgacttcgattacgaaaaaatggacaccgtcaaagtattctcc
agcttcgagttccagagtgaactggacctcaacgaattctgtcctggtgccggcgtctac
gaactccatgccgtgtctgtacaccaaggcgacgtcaactctgggcattactactgcttc
ttgcgacccccgccgcgtacgcagtgggtcagatttgacgacgacaaagtgtatcctgtg
tcggagtacgcggcgatcggcgacaacttcggaggcgacgaagaagatccgtgtaactac
cttgcaggtgagttccgtttttttcgccttcagagctctcgagcgccgcgctcgcgacaa
aaggtctacaacgcgtacattctggtctatgtgaagaagcgtctcgcgaaccagcttctc
gccgactgcaaccccatgaaggtgaaccctcaggtcgtcatcaggtgccgcacagaggag
cttctcatgaaactccgaaatcgaattcgccgcgtcctggaacagcgaatcaaggtgaag
gtgtaccatcctttgcaattcgtgaaccgccgttttctggatttgccgttggctacgatg
cgtccgctgctggagctgaagtcgagtcgctcggtggggattctgccgattcatgagcaa
atcaccgcgcgtctgtttagcaagttgtacggcgaagagggcactggcggcgagggcggc
gcctgcagtcagcgtgcagggaaggcttcgccgccgatcgcctttcttctgtacgcgatg
gatttcctggccgacgacgctcgcttcagtccgctctctctcgcagacaatccgtgtctc
ggggagattttccgcgccaagatggtggggaacagcgggagggccgggggcgttctcggc
gcccgcgtctatccgggaggcgcctcggacctgaactatccatacaaccggttcgacgcc
tgtctgtacttcctcgcggtgcccgagacgaacgcggtgattcgcgaggccgttgaccac
gatgaattctgcaggcgacaccagctgctcttcctcaagtactttgacgtcttcagcgca
aacacagtgctggtggaagcctctgagcctgtggcgccgcaggaccccaaaggccaacga
aaccgacaggaagacgacgctccggtctgcgccgcgctcgcgaagaaagttggcgaggat
ccctccgacgttcctgaggctctcagagacaacaacatcatttgcctcgacgttgtcctg
gttccgaatggctggaaactcgtctgccttcaaccgcatctgtatcgccttctcctgcgg
tgcatggaggacggattgacccggccgttcgcgctggagtctctgcgccgttatgtctcc
tctctggggtctctgccgcctctgttcgctgcttcctcgtccggcggcagtcgcctcttc
ttcccgggcgcgggggagaagcggcctctggtcgacgtcgcgacctcgcagagttgttct
ctcgctgcatgcgccgctgcctacggcgcaggcctcagtgcgacgctgtgtgggccagtt
ttcctgagcactcaggggaacttccctgccctgtcgagcagcagagagcagacacccgag
ctgccgcgagaacctgcgctcgtcctcgctctcgaaatcgagttccaggatctgaaaaat
cccacaagcctcacactctcttcgaagaaaaccttctcgcaagaaaaggcaactgctgtg
gtggacgagaagtctcgcgcgagtgtgtctccggaagaaggaacaggcgtcgctctctgg
ccctcgtcttcttcgccggcttcctcgtcgccgccctcggcgacgggtgcggcggcgcag
gcactttcgaccgcggctcgagcagcgttgggcgacgcagacccgttgggcgagaaggcc
gaggagaaggagacgctggcggcgaaggccgacgagaccgcgagttgcagcaccgccgac
gtctccaccactgtcgcctcgcctatgaacagcggtgcgttgccgccgtcgcgcgcggcc
ggtctcaagccggacgccgaagcgaaggcaggcgacagtctctccggccaggctcggggg
tctccagatggcgagaactcgaaagagagcagccctgtgtcgctcgacctcccctcacac
gcaccagggggaagcgacggcgctctcctcccttatctctctgctgcgcggggcggacgg
attccgagtgaccctccagagatgcctgtcctcccaagtcccgacttccaccactacagc
ctcaacaaagcgaatcgattcgtcttccagttccgactctacgaccctctcgagctcttg
aatcggccgatgaactgttgcggcatgttgctggaggattatccgcggccgagcgtgggt
tcgtcggcctgcctcgcgtcgcgcgacctgtcgctctctcactgctcttcaaacgaaaca
ctgagctccttcactctgtcctcgacttggtctgcgacgtctgcgctgacttcggatcct
tgcctccctgtctcggcgaccaagggaggcaacgctccgtcggtctctgcctcgttggtg
ctccccactgcctcgccctcccccgtcacgccgctggccgccgctgggccctttggagcc
ccagccggagccgcgaccgcggtcggaggctcagggctccagcgagctgttagtggcgca
ggcgccgacctcgagtgcgcagacggagacgcgacggccgacagcgaggaagacgaagat
ccctggatccacgttcccaagggccagcctgtggtcgcaaagatgctcgaggttgacgtc
cgagtcgcatgcaaccaggtcctgcgctacgtgagttggtatatgggcgtggatccttcg
cgtctgcttctgtttcctgagccgccgttgctgtcggacgcttcgtttgcgccggtgacc
atcgacagcctcgtttgtgccgtgagcgagggtggtgtctcccgtcgcgacggctctgga
ggttcgtctccccaggcgtcgctgcgtcggttgagcgtgaacgaagtattttcgcgcctt
gagaagaaggcccttttgggcgcgggatcccggctggggcgtcggcgtccgaggccggcg
ggatccttcgcgtttgcaggtcctgccgggagtcgccatcggatcttccacctcgcagtg
ctaccgcggcactactcgctctgctcgcgcgtcgtggaccctgcgaccttgacgcctgtg
cagctggaacgcgcgaaagaactcgttttccccgtctctttggggactgctgcggggggt
gcttccgccgctgcgctgcctccggaggctcccctgcaagacccgctgctccacttcgtc
gtgctcgttttcagccgacgcgtggagagtctcggatgcgtcgaaggcctcattccggcc
agatgtcccttctcctcgagacctctgactgtgaaggacttgattcacgcgatcctcgcg
cgaatgtctcccgcgcttcgcgcccagctcgtcgacgagagaagaagaagcgcctcccaa
gagggccgaagtatctctgccgagacaagcggcgagcacgcggccgagaagactgcgtcg
gcggatggcgcccgcgtctccgacgccgcgctcgccggtagcttgcgtctcctcgagtcc
tcggtggcgtcgctgcacgatctcgagaagacgcagcaaatccatagtctggcgctctac
gccggacagagcggccgacgactggacgggccgtccacgcaaaaccttttcgctgtgccc
ctgagactcgagctcgactggacacccgaagaaaaagaatccatcgagaacggggagttg
aaggttctgcaagttgttcatcaaaccccttcagacagagagtactttggatatccgttc
gagattcttgtccggccgagtgatacgctcaacgagattaagcacaaagtgaaagagaag
ctgctgctccctaagcctctttggagtaactggacgttctttcagtacgcagactgtaac
aggtcgtggaagggacctaacgaccgcctggactggcagcgctacgactctatcacgctc
atcgctgagcatccggctccgtactcaaagatgcgcttgccgacggccatgaagatcgcg
tag

DBGET integrated database retrieval system