KEGG   Toxoplasma gondii: TGME49_090950Help
Entry
TGME49_090950     CDS       T01093                                 

Definition
clathrin heavy chain, putative
Orthology
K04646  
clathrin heavy chain
Organism
tgo  Toxoplasma gondii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tgo04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1731 aa AA seqDB search
MAQQFPIQLHSVVNLADQGVSASSFRFGNVAMHGDKNLVVKDTETNELFIFSLSVREVHE
GRVSPSSPGFSFTKKPTQAEAALMHPSEKVVALRAKTEGSAGHMIQVLNLETKVRLGTAQ
MNEPVVYWRWVAPTLLALVTDRAVYHWTVGENGETTAEPEKVCSREGRLADAVQIISYAV
DKDLKWCILTGISTQDGGKTIDGSMQLYSMELKKQQQLEGHAACFNNIVIDEAVGPQPVI
CFTEKKRGSPDFKLHIRDIYSSRDGGQTPLRLAVDLRMPEDAPTDFPLSIHISQKFGVVY
IVTKGGYLILLDALTGTELFRHRILQDAVFLATDSPQTGGILTVNKRGLVCLCNINLQAL
IPYINQALVYVPNRQQIATSLAKRYGLPGAEETLMQEFNQHFASGNFKTAARIAATLKSG
VLRTAQVIQQFKSVPTQPGQTSAILVYFSTLLEYDSLNAVESLELVRPVAVQGRKDFVEK
WLREGKLECTEELGDVVRTLDAQLAVRVYREAKAGAKVLQTLTELGNFDEIIAFAKETKL
EADYAGLLRNLVNVHPENAVKFAQQLLSSEPPLADVTQVSEVLLQQHKYQEFTSLMLDFL
KGNKPEQGPLQTRLLEVNLLHSPQVAETIFQMEMLTHFDRAKIAALCEKVGLSQRALELY
TDIADIKRVMLQSGGKISQEFTQQFFGNLPPDASLEILTDMLRSSSQNLQAVVAVAIKFH
GQIGTTKLVEMFEKFSSYEGVFYFLGSILAFSSDPEVHFKYIEAAAKLNHTQEVERVCRE
SKCYEPQRVKEFLKQVKLPDPRPLIYVCDLHGYVTELAEYLFKNSLLKYIEVYVSRVNSA
NAPLVIGTLIDQDAAEDFIRNLLQSVRGGCSAQQLVEEFEKRNRLRLLLQWLEARVAEGN
QEPAVHNALAKIYIDTNRDAESFLKTNAYYDSLVVGKYCEERDPHLAFTAYKRAWGACDE
QLVELTNKNGLFRLQARYLVERQAPELWAYVLREENPHRRQAIDQVVSSALPESSSADEV
SAAVNAFINAQLPHELIELLEKIVLHNSDFSNNKNLQNLLILTAMKADSSRIIDYVNRLH
NYDGAAIAQVAMEYGLREEAFTIYKRFGLFGEAADTLLKSAEEGSEADLERAVEFAQRCN
EADVWRKLGRAQLRQKRVRDAIESFLKAGDGDVYKEVVEAAAAEDAYDALVDFLLMARKK
ITVKDQVIDSELVYAYAKTDRLEEMDAFLSGTNTANVQAVGDRLFAEQRYKAAKLLYASL
PNYAKLASCFVRLEDFAASVDAARKAKNPKTWKEVAFAALSKGELKCAHAAALSLIVHPD
HLDSLIERYEQLCLFKELIELLEQGLQGERTHVGLYTELGVLYATYESSKLMDYIRQHSG
KVNIPRLIRACERQSLWKEAVYLHMNYDEYEQAANCLIMHPAAWSHELFVQILQKVSNSD
VFYRAISFYLEYHPLQLCLLLKSLDKKLDHSRVVQHVRKAGHLAVVEKYLRETQHLNITA
VNEAVNELLVEGEDVDGLRESILEYDNFDQLALAQTLENHPRVEMRRLAALLFKKNRKFK
QAIELSKRDRQYQDAIDAARDSGNTQLVGDLLRFFLADLEDPAGFAACLYTCYPLVKPDV
ALELAWRHKCMDYCMPFLIQVVREVTTRVDALDKKEETREKEEEKQKNAPNDYVPDYTMP
PTGSPLLPGMGGLALMPPSYTPQSNAFPPTLGASGMMGSAPANLGQSFAPF
NT seq 5196 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaacaattccccattcaactccactccgtggtcaacctggcggaccagggcgtg
agtgcgagttcctttcgcttcggcaacgtggcgatgcacggcgacaagaatttggttgtg
aaggacacggagacaaacgagctgttcatcttctctctgtctgttcgtgaggtccacgaa
ggccgcgtttcgccgtcgtcgccaggtttctccttcaccaagaagccgacgcaggcggag
gcggcgctgatgcatccgagcgagaaggtggtcgccctcagagccaagaccgagggctct
gctggacacatgattcaagtgctgaatctcgaaacgaaagtccgactcggcaccgcgcaa
atgaacgagccagtcgtctactggcgctgggtcgcgccgactctcctcgccctcgtcacc
gaccgcgccgtctaccactggactgtcggagaaaacggcgagacgacggccgagccggaa
aaagtctgcagtcgtgaaggcagactcgcggacgccgtccagatcatctcctacgccgtc
gacaaagacctcaagtggtgcatcctcacgggaatctccacgcaggacgggggaaagacg
atcgacgggagcatgcagctgtattcgatggaactgaagaagcaacagcagctcgagggt
cacgctgcctgcttcaacaacatcgtgatcgacgaagctgtgggaccgcagcccgtgatc
tgtttcaccgagaagaaacgaggctctccggacttcaagctccacatccgagacatctac
tcctccagagacggcggccaaactcccctgaggcttgcggtcgacctgaggatgccggaa
gacgcgccgacggactttccgctgtctatccacatcagccagaaattcggtgtcgtctac
atcgtcaccaaggggggctacttgattcttctggacgcccttactggaacagagctgttc
cgacaccgcattctccaggacgccgtcttccttgcgacagattctccgcagacgggaggc
attttgacggtgaacaagcggggactggtttgcctgtgcaacatcaacctgcaagcgctc
attccgtacatcaaccaggccctcgtctacgtcccgaatcgccagcagattgccaccagt
ctggcgaaaagatacggtctcccgggagcagaagaaactctcatgcaggagtttaaccaa
cactttgcgtcgggcaacttcaagacagccgctcggattgcggcgacgctgaagagcgga
gtgctgcggactgcgcaagtgattcagcagttcaagtcagtgccgacccagcctgggcag
acgtccgccatcttggtctacttttcgactctgctcgagtacgacagtctgaacgcagtc
gagagtctggagctggtgcggccggtcgccgttcagggcagaaaggacttcgtggagaaa
tggcttcgggaggggaagctggagtgcacagaggagctgggcgacgttgttcggacgctg
gacgcgcagctcgctgtgcgggtctatcgggaggcgaaggcgggagcgaaggtgctgcag
acgttgacggagttggggaacttcgacgagatcatcgcgttcgcgaaggaaacgaagctg
gaagccgactacgccggcttgctgaggaacctggtgaacgtgcatcccgagaacgccgtg
aagtttgcgcagcagctgctctcgagcgaaccgccgctcgcggacgtgacgcaggtgtct
gaggtactgctgcagcaacacaagtatcaggaattcacttcgctgatgctcgactttttg
aaggggaacaagccggagcaagggccgctgcagacgcggctgctcgaggtgaatctcttg
cactcgccgcaagtggcggagacgatcttccaaatggagatgctcacgcactttgaccgc
gcaaagatcgctgcactctgcgagaaggttgggctctcgcagcgcgccctggagctctac
acggacattgcagacatcaaacgcgtcatgctccagtccggcgggaagatcagtcaggag
ttcacgcagcagttcttcgggaacctgccgccggacgccagcctcgaaatcctcactgac
atgctgcggagctcgtcgcagaacctccaagccgtcgtcgccgtcgccatcaagttccac
ggacaaatcggcacgacgaagcttgtggaaatgttcgaaaagttcagcagctacgagggc
gtcttctacttcctcggttccatcctcgccttctcctcagacccagaagtccacttcaag
tacatcgaggcagccgcgaaactgaaccacacgcaagaggtcgaacgcgtctgcagggaa
agcaagtgctacgagccacaaagagtcaaggagttcctcaagcaagtgaagcttccggat
ccgcggccgctgatttacgtctgtgacttgcacggctacgtcacggagctcgcagagtat
ttgttcaagaactcgcttctgaagtacatcgaggtgtacgtatctcgcgtgaactctgca
aacgcgccgcttgtgatcggcactttgatcgaccaagacgcggcggaagacttcatcaga
aaccttctgcagagcgtccgcggcggctgctcggctcaacagctcgtcgaggagttcgag
aaaagaaatcgcctccgtcttcttcttcagtggctggaggcgcgcgtcgcagaaggcaat
caagaaccggccgtccacaatgctctcgcaaaaatctacatcgacacaaacagagacgcg
gagagtttcttgaagacgaatgcgtactacgactcgctggtcgtgggcaagtactgcgaa
gaacgcgacccccatttagccttcaccgcgtacaaacgcgcgtggggtgcttgcgacgaa
cagctcgtggaactgacaaataagaacggactcttcagactgcaggcgagataccttgtc
gagcgccaggccccggagttgtgggcgtatgtgttgcgtgaggagaatcctcaccgtcgc
caggctatcgaccaggttgtgtcttctgcccttcccgagtcgtcctctgcagacgaagtt
tctgcagcagtgaatgcgttcatcaacgcgcagttaccccacgagttgatcgaactgctc
gagaaaattgtgctccacaacagcgactttagcaacaacaagaacctgcagaatctcctc
atcttgactgcgatgaaggcggacagcagccgaatcatcgactacgtcaaccgccttcac
aactacgacggagctgccattgcccaggtggcgatggagtatgggcttcgagaggaggcg
ttcacgatttacaagaggttcggactgttcggggaggctgcagacactctgctgaagtcg
gcagaagagggcagcgaggccgacttggagagggccgtcgagttcgcgcagcgctgcaac
gaggcggatgtgtggaggaagctggggcgcgcgcagctgaggcagaagcgggtgcgagac
gcgatcgagagtttcctgaaggccggcgacggcgacgtgtacaaagaagtggtggaggcg
gcggctgcagaggacgcgtacgacgcgctggtcgacttcctcctcatggcgagaaagaag
atcactgtgaaggaccaagtcatcgactcggaactcgtctacgcgtacgcgaaaaccgac
agactggaggaaatggacgcctttctcagtggaacaaacaccgcgaacgtgcaggcggtc
ggagaccggctcttcgctgaacagcgctacaaggctgccaagcttttgtacgcgtcactg
ccgaactacgcgaagctggcgagttgcttcgttcgcttggaggacttcgcggcttcggtg
gacgcagcgcggaaggcgaagaatccgaaaacgtggaaggaagttgcgttcgcggccctc
agcaaaggagaactcaaatgtgcgcatgcagccgctctcagtctcatcgtccaccccgac
cacctggacagtctgatcgaacgctacgaacaactgtgcctgttcaaggaactgattgag
ctcctggagcaaggtttgcagggagagcgtacgcacgtcggcttgtacacggagttgggt
gtcctctacgcgacctacgagagcagcaagctgatggactacattcgccagcacagcggg
aaagtgaacattccccggttgatccgcgcctgcgagcggcaaagcctgtggaaagaggcg
gtgtatctacacatgaactacgacgaatacgaacaagcagcgaactgcctcatcatgcac
cctgcagcttggtcgcacgaactcttcgtccagattctgcaaaaggtctcgaacagcgat
gtgttctaccgagccatcagcttctacctcgagtaccatcccctgcaactctgtctgctt
ctgaagtctctggacaagaagctcgaccactcgcgggtcgtgcagcatgtgcgaaaggcc
ggccatctcgccgtggtcgagaagtacttgcgcgagacgcagcacctgaacatcaccgca
gtcaacgaagccgtcaacgagctcctcgtggagggtgaagatgtagacggactccgagaa
agcattctcgagtacgacaacttcgaccaacttgctctcgcccagacgctcgaaaaccac
cccagagtcgaaatgcgccgattggccgctctgctcttcaagaaaaacagaaaattcaaa
caagccattgaactctccaaacgcgatcgacaataccaggacgccatcgacgctgcgcgc
gactcgggcaacacccaacttgtcggagatcttctgagatttttcctcgccgacttggag
gatccagcaggcttcgcggcgtgtctgtacacctgctatcctctcgtcaagcctgacgtc
gcactcgagctggcttggcgccacaaatgcatggactactgcatgccgttcctcatccag
gtggtgcgggaggtgacgacgcgagtggacgctctggacaagaaggaagaaactcgagag
aaggaagaagaaaaacagaaaaatgctcccaatgactatgtgcctgactacacgatgcca
ccgacaggttctccactgttgcctggcatgggcggactcgccctcatgccgccgtcgtac
actccgcagtcgaatgcctttcctccaacgctgggggcctctggaatgatgggatctgct
cctgccaatctcggacagtctttcgctcccttttaa

DBGET integrated database retrieval system