KEGG   Toxoplasma gondii: TGME49_091640Help
Entry
TGME49_091640     CDS       T01093                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tgo  Toxoplasma gondii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TGME49_091640
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TGME49_091640
Enzymes [BR:tgo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TGME49_091640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MEDSKDKAAFSTFCRQLSAAFRHDLIQRAEEKFFRSQLTSVSRLSPPDVVLFVAVASQLR
QLLLKSERDAAACPGTLSETSVQNGCSEGAWCELLQGKNIATVFFEPSTRTRCSFEAATL
RLGGRVISCGDMQTNSSTKKGESLEDSIRMFAAYSDCIVLRHPEKGSMERATRALKDVRV
GRPPCCLLSAGDGAGEHPTQALLDLLTVVQLRPRWWEAQLKKIEGDSSCIRDPNEKNNLV
EHQPEATLRVAFVGDLKNGRTVHSLALLLSRFDCHLTAVSTEASALPASVAERVRENFKA
QGLSGEERLICSSDFPEAIRTSDVLYMTRLQSERLDHPVVPTSGQQFPPSDYQLTRGLLE
KHARPHLKVMHPLPRREEIAVDVDDTNHCAYFTQAENGLYMRMALLSVFLNRGTARMLLG
QAS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaggacagcaaggataaagctgctttttctactttttgccgacagctgtccgcggcc
ttccgccatgaccttatccagcgtgcggaagagaagtttttcaggtcacaactcacttca
gtgtccaggctctcccctccagatgttgtcctttttgttgccgtggcctcgcaactccgc
cagcttctcctgaaaagcgaacgcgacgctgcagcctgtcctggcactctctccgagaca
tctgtccagaatggctgcagcgaaggcgcgtggtgtgagcttctccaggggaaaaacatc
gcaacggtgtttttcgagcccagcactcgcacgcggtgctcttttgaggccgccaccctt
aggctggggggccgggttatcagctgtggcgacatgcagacgaattcctccactaagaag
ggagagtctctggaggacagcattcgcatgtttgcagcttacagcgactgcatcgtgctc
cgacaccccgagaagggctctatggaacgcgcaacccgggccttgaaagacgtgcgagtg
ggaaggccgccttgctgtttgctcagtgcgggcgacggagcaggggaacacccgacgcag
gctcttctcgatttgctgactgtcgttcagctccgcccccgctggtgggaggcgcagctc
aaaaagattgagggcgacagcagctgcatccgagatccgaatgagaaaaataacttggtc
gagcatcaacccgaagcgacgctacgggtggcttttgtgggggacctcaagaacggcagg
actgtgcattctctcgcgttgcttctgtcgcgtttcgactgtcacttgacagccgtcagc
accgaggcctcggctctgcccgcaagtgtcgcggaacgcgtccgagaaaatttcaaggct
cagggactgtctggcgaagagagacttatctgctcgtcagatttccctgaggccattcgg
acatctgacgtgttgtacatgactcgtctccagtctgagaggcttgatcatccagtggtg
ccgacaagcggacagcagttccctcccagcgactatcaactgacgcgaggtctgctcgag
aaacatgcccgcccccatttgaaggtcatgcaccctctccctcgccgtgaagagatcgcg
gtcgacgttgatgatacgaatcattgcgcctactttacccaggctgagaacggactctac
atgcgcatggcgctgctgtcagtctttttgaatcgaggcacagcacgcatgcttctgggt
caggcgtcttaa

DBGET integrated database retrieval system