KEGG   Toxoplasma gondii: TGME49_104480Help
Entry
TGME49_104480     CDS       T01093                                 

Definition
3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2, putative (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TGME49_104480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MAFSLPGMVLERALSVTRSLLKMLTKFLLQEPAAEHVEVDKSGVYLFWAAVGLAAFGLVT
VVGQIFIRAPWGKFRNDAKSRVWGPSVPCAVAWMIQECPSFFIPFSVLVGTEWLAGRPIN
KILLVLFTTHYAHRSLVYPARLYVHTRYQENQSMPLGISAMAVLFCTYNGMIQSWSAISF
DYSSELDPFLAPRASVDDCSAALRLISGVCVFLWGMSVNIRSDYILMKLRVTSDRITPNP
VLSASAYRIPEGLWFNYVSCANYFGEICEWAGYAIACNTYVALSFAVFTLCFLTGRGVQV
HRWYLQHFEERYPSGRKAVIPFIV
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctttttctttgcctggaatggtgctagagagagcgctgtccgttaccagaagcctg
ttgaaaatgctcacaaagtttctgcttcaagaaccagcggctgaacatgttgaagttgac
aaatctggcgtatacctcttttgggcggccgttggacttgcagcgtttggactcgtcacg
gtcgtgggacaaatatttatcagagctccatggggaaagtttcgaaacgatgcgaagagc
cgagtgtgggggccttcggttccttgcgccgtggcgtggatgattcaggagtgtccatcg
tttttcataccgttttccgtgctggttggaacagaatggcttgcgggtcgccccatcaac
aaaatcctgctagtgctgttcaccacccactacgcccacaggtcgctagtttaccccgct
cgtctctacgttcacacacgctaccaagaaaaccagtcgatgccgcttggaatttccgca
atggcggtccttttctgcacgtacaacggcatgattcaaagttggagcgcgatatctttc
gactactcctcagaactcgacccgttcctagcccctcgtgcttctgttgatgattgctca
gcggcacttcgtcttatatccggagtttgtgtctttctatggggaatgtcagtgaacatc
cgttcagactacatcctgatgaagttgcgtgtcactagcgaccgtattacgccgaatcct
gtactctctgcttctgcttacagaattcctgagggtctctggttcaactatgtatcgtgt
gcaaattactttggcgagatctgtgagtgggcaggttacgccatcgcatgcaacacgtac
gtggcactgagcttcgctgttttcactttatgctttctcacgggtcgtggtgttcaagtg
catcgctggtacttgcagcacttcgaggaaagatacccctctgggaggaaagcggtaatt
ccgttcattgtgtaa

DBGET integrated database retrieval system