KEGG   Toxoplasma gondii: TGME49_105030Help
Entry
TGME49_105030     CDS       T01093                                 

Definition
ribokinase, putative (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tgo  Toxoplasma gondii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TGME49_105030
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TGME49_105030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 439 aa AA seqDB search
MALDTPATSLAARDPLDLSTSQDAVLAVRSAVKKVRSPNLVVMGGANRDVNLRVRSLPLH
GETVASAKPVIYRGGKGANQAVQAALLMNRGSEEPSADDDAAKKKQLAKTDGRVALICKL
GADETGSEYRNYLQNIGIDMTGVLTAKGEPTGCAYVTVAQDGENTIVYVQGANNCLTSED
LRNPELAALIQNAKVFACENGVRGDVIVAALKLAKCSPENVVTVFTPAPVATVPLEAFAY
SDYVVVNENEARELYSLTPVTKTQDTAGNVFEEREGSDDDWPPLSKRGGSDKPFPSPAAL
RSKLVLLGQKATTVLGAEREDEARETVRVRGGVHPAECNVIVTKGKDGCTLIRQRSDGNH
RVSVQYFEQKRRVPPAQVVDTVGAGDSFCGAFVYFLGEEGLSVNEAIEKAGIVASFSVQK
RGASESYADRELLRGVVFE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgacactccagccacgtcgctcgccgcgcgagatccgctcgacctgtcgact
tcgcaagatgcagtgctggcggtgcgttcagccgtgaagaaagtgagaagcccgaacctc
gtcgtgatgggcggagcaaatcgcgacgtgaatctccgggtacggtccttgcccttgcac
ggcgaaactgtcgcaagcgcaaagccagtgatctaccgcggcggtaagggtgcgaaccag
gcagtccaggctgcgctgttgatgaaccgcgggagcgaagagccctccgcggacgacgac
gcagccaaaaaaaagcagctggcgaaaaccgacggcagagtcgcgctgatctgcaagctc
ggcgcggacgaaacgggctccgagtaccgaaactacttgcagaatatcggaatcgacatg
accggcgttctgacggcgaagggagaaccaaccgggtgcgcatacgtaacagtggctcaa
gacggcgaaaacaccatcgtctacgtccagggagcaaacaactgtctgacttctgaagat
ctgaggaaccctgaactagccgcattgatccagaacgcgaaagtgttcgcttgcgagaac
ggcgttcggggagacgtgattgtggctgcgctgaagctggccaaatgttcgccagagaat
gtcgtgactgttttcacgcctgctccggtggcaaccgtgcctctggaggcctttgcgtac
tcggactacgtggtggtgaatgagaacgaagcgcgcgaactgtatagcttgacgccagtc
acgaaaacgcaggacacagcaggaaatgtgttcgaggagcgggaaggttcagacgacgac
tggccgccgctgagcaagcgcggcggcagcgacaaaccttttccttctccggctgcgctt
cgatccaaactggtcctcttggggcagaaggcgaccaccgtgttgggagctgagagggaa
gacgaggcgcgcgagacagtccgtgttcgcgggggggtgcacccggccgagtgcaacgtg
attgtcacgaaaggcaaagatggatgtacgctgattcgacaaaggagtgatggcaaccac
cgggtgtctgtccagtactttgagcagaagcggcgcgtcccgccagcgcaggttgtcgac
acggtcggagcgggagattccttctgcggagctttcgtgtactttctgggggaggaaggt
ctcagcgtaaacgaagccattgaaaaggcggggattgtcgccagcttctccgtccagaaa
cggggcgcaagcgaaagctacgctgaccgcgagctcctcaggggagtcgtcttcgagtga

DBGET integrated database retrieval system