KEGG   Toxoplasma gondii: TGME49_110700Help
Entry
TGME49_110700     CDS       T01093                                 

Definition
serine/threonine protein phosphatase, putative (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tgo  Toxoplasma gondii
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    TGME49_110700
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TGME49_110700
Protein phosphatases and associated proteins [BR:tgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     TGME49_110700
Transcription machinery [BR:tgo03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     TGME49_110700
Messenger RNA biogenesis [BR:tgo03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     TGME49_110700
Spliceosome [BR:tgo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TGME49_110700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 306 aa AA seqDB search
MVSLDVDVDAVISKLLEVRGSRPGKPVQLTEAEIRGLCHKSREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCMHGGLSPELN
SMDQIRRIVRPTDVPDTGLLCDLLWSDPEKEISGWGENDRGVSFTFGQDVVHNFLRKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEK
KKGMAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcattagacgtcgatgtcgacgccgtcatcagcaagctcttggaagtccgagga
agccgaccggggaagccggtgcagctcacagaggctgagattcgaggcctctgtcacaaa
tctcgggaaatcttcatcagtcagccgattctgctggagcttgaggccccgataaagata
tgcggtgatattcacggccagtactacgatctactacggttgtttgaatacggtggtttt
cccccagaagcaaattatctttttttaggcgactacgttgacagaggcaaacagagtctg
gagactatctgtctacttctagcttacaagatcaagtatcccgaaaacttcttcctgttg
cgtggcaatcatgaatgcgcctccatcaaccggatctacggcttctatgatgaatgcaag
agacggtacaacattaaactttggaagacattcacggattgcttcaactgccttcctgtg
gcagccataatcgatgaaaagatcttctgtatgcatggtggactgtcgccggagctcaac
agcatggaccaaatcagaaggattgtcaggcccactgacgttcctgatacaggtcttctt
tgtgatctgttatggagcgacccagaaaaggagatatccgggtggggcgagaatgatcga
ggagtctcgttcacattcgggcaggatgttgtccacaacttcctcagaaagcatgatctg
gacctcatatgtcgggctcaccaagtggtagaggatggctatgagtttttcgcgaaacgt
caattggttacgttgtttagtgcccctaactactgcggagagtttgacaatgcgggtgca
atgatgagcgtcgacgagacgctcatgtgttcgttccagatcctcaaaccagtggaaaag
aagaaaggcatggccaaataa

DBGET integrated database retrieval system