KEGG   Toxoplasma gondii: TGME49_111090Help
Entry
TGME49_111090     CDS       T01093                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15 3.1.3.16)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
tgo  Toxoplasma gondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 607 aa AA seqDB search
MDSIRISVKWNKQEFENVEVDLSEPLALLNAQLMTLTGVPADRQKLMANRKLVKTVDDLR
AAAKGGKNLRVTMLGTAEGAELQQPLERTVFVEDLTPAERAKLLREKNIEPLPPGITNLG
NTCYLASVLQMLRPCRELTAAVKNDMKNSTGESAAAYTALSGAVGAAYRLALALKDFHSH
WDSTAGAAQPVLLVHALREAFPQFARKAAAGPGGLGGGFMQQDAEECLSCLVNVLGESLP
ISQNRKAFEALPVRYEQATNFVDALFAFDMQVKTCRTRGEEALADGAAEVKREKNTKFTC
FLGTMQNPVNTLDEGVKFSLAEERIDLTAAGNAGSNAPLDAEKEMLLRSMQFASLPFYLL
VQFMRFEWKRAGGQAEKAKVCRSVKFGPTLDLYLHCTDELKESLRIGRAVVALRREREAG
GHSSDSKTEETNSKTEPTCADAAMTEKNEDSNVSSTGSTRVYRTGFFQLLGIVTHQGRHA
DSGHYVGWTKKDQREPRVIEKEKKEKEREEELQREENPSGMAVKKKKASPVDMWVKFDDD
KVSETPWDQIDLAGGRSDYHIAYLLLFREILVDATEEEVKTVEKNHAEQLAQTDAAKKSN
GEEKNTQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggattccatcaggatcagcgtgaaatggaacaagcaggaatttgagaatgtcgaggtg
gatctcagcgaacctcttgcgctcctcaacgcgcagctcatgactttgacgggagtgcca
gcagaccgtcagaagctgatggcgaatcgcaagctggtcaagactgtagacgacctgaga
gccgcggcgaagggtggcaagaacctgagggtgacgatgctcggaactgccgagggagcc
gagcttcagcaacctctggagagaactgtgtttgtcgaagatctgactcctgctgaacgc
gccaaactgctgcgagaaaagaacatcgagcctctgcctcccggcatcacgaatttggga
aacacctgctacctggcgtcggtcttgcagatgctcagaccctgtcgggagctcactgca
gcagtcaaaaatgacatgaagaactcgactggagaatccgctgcagcctacacagctctc
tcaggcgccgtcggcgctgcctaccgcctcgccctcgcgctgaaagacttccacagtcac
tgggactccacggcgggagctgcgcagcctgtgcttctcgtgcatgctcttcgcgaggcc
ttcccccagttcgcgagaaaagcggcagctggaccaggggggctcggaggcggcttcatg
cagcaggacgcagaggagtgcctcagctgcttggtgaacgttttaggcgagagtctgccg
atttctcagaaccgtaaggcgttcgaggcgctgcccgtgcgctacgagcaagcaacgaac
ttcgtcgacgcgttgttcgctttcgacatgcaagtgaagacctgcagaacgcgaggcgag
gaggctctggcggacggcgccgcagaagtgaagcgcgaaaaaaacacaaagttcacctgc
ttcctcgggaccatgcagaacccggtcaacacgctcgacgagggtgtgaagttctctctc
gcagaggaacggatcgacctaacggctgcggggaatgcagggagcaacgcgcctctggat
gcggagaaggagatgctgctgcggtcgatgcagttcgcgagtctgcctttctacttgctc
gttcagttcatgcggttcgagtggaagcgcgcgggcggccaagctgaaaaggcgaaagtc
tgcagaagcgtcaagttcggacccactctcgacctctacctgcactgcaccgacgagctg
aaggagagcctccgcatcggccgcgcagttgtggctctgcgtcgagagagagaagcagga
ggtcactcgagtgactcaaagaccgaagaaacgaattccaagacggagccaacgtgtgca
gacgcggccatgacggaaaagaatgaggactcgaatgtgtcttcgacaggaagcacgaga
gtgtatcgaacaggtttttttcagttgctgggcatcgtgactcatcaaggccgccacgca
gacagcgggcactacgtcggctggacgaagaaggaccagcgagagcctcgagtgattgag
aaggagaagaaagagaaggagcgcgaggaggagctgcagcgggaagagaaccccagcgga
atggctgtgaagaagaaaaaggcttctccagtcgacatgtgggttaaattcgacgacgac
aaagtctctgagacaccctgggatcaaatcgacctcgccggcggccgcagcgactaccac
attgcctacctgcttctcttccgagagatcctcgtcgatgcgacagaggaggaagtgaag
acggtcgagaagaaccacgcagagcaactggctcagacagacgccgcgaagaagtccaac
ggcgaagagaaaaacacccagtaa

DBGET integrated database retrieval system