KEGG   Toxoplasma gondii: TGME49_111360Help
Entry
TGME49_111360     CDS       T01093                                 

Definition
cGMP-dependent protein kinase, putative (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tgo  Toxoplasma gondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 994 aa AA seqDB search
MGACISKNSSARVSRSSALSASKQTVAASAPPGAAGDETSATGAAEEASRNSLARVDGTR
ASAAELERAPDGVCPDREEPGTANAEQGGVTEKKDTRETLAGMNSPKTLEAEAQEDDLKR
EAPNQDVPSEAPEGPKEKPGGDRKPAQKAILKQDDSHTEEEKLNAHLAYREKTPADFALI
QDSLKANLVCSSLNEGEIDALAVAMQFFTFKKGDVVTKQGEPGSYFFIIHSGTFDVLVND
KRVNAMDKGKAFGEIALIHNTERSATVVASSTEGALWGVQRHTFRETLKQLSSRNFAENR
QFLASVKFFEMLTEAQKNVITNALVVENFKPGQPIVKEGDAGDVLYILKSGKAKVSIGGR
EIRMLRKGDYFGERALLYKEPRSATITAEEFTVCVSIGRELLDRVLGNLQHVLFRNIMVE
ALQQSKVYELFQGDQLSKLIEAAVVKDYGADYVILDKENKTKGIRFFFVLEGELSVYAYA
QNPATKEEERKLAATLKRGQAFGEEYVLNPTRPFNHYVKSVGPCKLALFTSSVLTATLGG
EDIDETLDFNNKRAIIRKMYIFRYLSDHQMTMLIKAFKTVRYMSGEYIIKEGERGTRFFI
IKAGEVAILKNNKRLRTLGRHDYFGERALLYDEPRTASVCANSAGVDLWVVDKSVFNEII
KGPMLAHLEERIRMQDTKVEFQDLQVVRVVGRGTFGTVKLVRHVPTDIRYALKCVSRRSV
IALSQQQHIRLEREIMAENDHPFIIRLVRTFRDKEFLYFLTELVTGGELYDAIRKLGLLA
RSQAQFYLASIVLAIEYLHERNIAYRDLKPENILLDSQGYVKLIDFGCAKKMQGRAYTLV
GTPHYMAPEVILGKGYTLTADTWAFGVCLYEFMCGPLPFGNDAEDQLEIFRDILTGKLVF
PHYVTDQDAINLMKRLLCRLPEVRIGCSINGYKDIKEHAFFGDFDWDKLAGRGLPPPLAP
KGETYAEDTEQSSFELDEDDTIVLEDEYDWDKDF
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcttgcatttccaaaaatagttcggctcgcgtttcacggtcttctgctctgtcc
gcctcgaaacaaacagttgcggccagtgcaccgccaggagcggcaggcgacgagacctct
gcgacgggtgctgccgaagaagcttcgaggaactcccttgccagggtagacggaacgcga
gcctccgcagcggagttggagagagctccggacggtgtgtgcccagaccgcgaggaaccg
gggacggcgaacgccgagcaaggaggcgtgacagagaagaaagacactagagagacactg
gcagggatgaactctcccaagactctggaggcggaggcgcaagaggacgacctcaagcgc
gaagcgccgaaccaggacgttccctctgaggctccagaaggcccgaaagaaaaacccggc
ggagaccggaaaccggcgcagaaggcgattctgaagcaagatgactcgcacacggaggaa
gagaaactcaacgcgcacctggcatatcgcgagaagacgcctgcagactttgcgctgatc
caagacagcctgaaggcgaatcttgtctgctcctctctgaatgagggagaaatcgacgct
ctcgcagtcgcgatgcagttcttcaccttcaagaaaggcgacgtggtgaccaagcagggc
gaacctggaagctactttttcatcattcacagcgggacgtttgacgtgctcgtcaacgac
aagcgcgttaatgcgatggacaagggaaaagcctttggagaaatcgcgctcattcacaac
accgaaagatctgcgacggttgtcgcaagctccacagaaggtgccctctggggtgtccag
cgtcacactttcagagaaacgctgaagcagctgagcagccgaaactttgcggagaacaga
cagtttttggcctccgtcaagttcttcgaaatgttgacagaggcgcagaaaaacgtcatc
accaatgcgctggtcgtggagaacttcaagcctggacaacccattgtgaaggaaggcgac
gcaggagacgtcctctacatcttgaagagcggcaaagcgaaggtctccatcggcggacgg
gagatccgcatgctgcggaaaggcgactacttcggagagcgcgcgttgctgtacaaagag
ccgaggagcgcaaccatcacggcagaagagttcaccgtctgcgtgtcgatcggccgcgag
ctgctggatcgcgtcttgggaaatctgcagcacgttctgttcagaaacatcatggtcgag
gctctgcagcaaagcaaagtctacgaattgtttcaaggcgaccagctgagcaaattgatc
gaagcggccgtggtgaaggactacggcgcagactacgtcattctggataaggaaaacaag
acgaagggaattcgcttcttctttgtcctcgaaggagagctgtcggtgtacgcctacgca
caaaatccagcgacgaaagaggaagaacggaagctcgcagcgactctgaaacgcggccaa
gcattcggtgaagaatacgtccttaatcccactcgacctttcaaccactatgtcaaaagt
gtcggcccttgcaagctcgctctgtttacttcgtccgtgttgacggcgactttgggaggc
gaagacatcgatgagacgctggacttcaataacaaacgcgcgattattcggaagatgtac
attttcagatatctgtcagatcaccaaatgacgatgctcatcaaagctttcaaaactgtc
agatacatgtcgggagagtacatcatcaaagaaggcgaacgcggcacacggttcttcatc
atcaaagccggtgaagttgcgattctgaagaacaacaagcgcctccgcaccctcggccgc
cacgactattttggggaacgggcgttgctgtacgatgagcctaggacggcctctgtgtgc
gccaattctgcgggggtcgatctctgggtcgtcgataagtcggttttcaacgaaatcatc
aaggggcctatgcttgctcacttggaggaaagaatccgcatgcaagacaccaaggtcgag
ttccaggacttgcaagtggtcagagtggtcggcagaggaaccttcggcaccgttaagctc
gtgcgccatgtgccgacagatattcgctatgcgctcaagtgtgtctcaaggcgaagcgtc
atcgctctcagtcagcaacaacacattcgcctggaacgagaaatcatggcggaaaacgac
catcctttcatcattcggctagtgaggacgttccgcgacaaggagttcctatacttcctc
acggaactcgtcacaggaggcgaactgtacgatgccatccggaagctaggactgcttgct
cggtcgcaggcccagttctacctcgcctccattgtcctcgccatcgagtatctccacgaa
cgaaacatcgcgtacagggacttgaagcctgagaacattctcctcgacagccaaggctac
gtcaaactcatcgatttcggctgtgcgaaaaagatgcaaggtcgcgcctacacccttgtc
ggcacgcctcactacatggctcctgaagtcattcttggcaaggggtacacgctgacggca
gacacttgggcgttcggcgtctgcctgtacgagttcatgtgcggacctctccccttcgga
aacgatgctgaagatcaactggaaatcttccgagacattctcacaggaaaactcgttttc
ccgcactatgtcaccgaccaagatgcgatcaacctgatgaagaggcttttgtgtcgtctc
cctgaggtccgaatcggatgctccatcaacggctacaaggacatcaaggagcacgcattt
ttcggagacttcgactgggacaaactggcaggtcgtggcttgccgccacccctcgcaccg
aaaggcgaaacctacgcagaagatactgaacaatcctctttcgagctggacgaggatgac
acgatcgttttggaagacgagtatgactgggacaaggatttctga

DBGET integrated database retrieval system