KEGG   Toxoplasma gondii: TGME49_115130Help
Entry
TGME49_115130     CDS       T01093                                 

Definition
protein-L-isoaspartate O-methyltransferase, putative (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TGME49_115130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MVQPLPPGKKCVCPPFRILRRVATVSLLAAFSSGVCTPHAGVSQLCRQAVLENLTSISYF
FRVLSSASRLQSKGTTSCSLSPFALAQNPELRPSDHTRLPSSSLACASGGSVDCRAFSLK
KAHLKTGLFAARTRLFLSPLLRHLLQPSLVSFLSSPATFQRFLSVAERPGTPSAYTRQSA
DRREPRKTEREPAATSASLPLHLPSRAPRRFAPVLLPATSIVSQQERGENRDETREERSE
AGEKGEESKLDADAEESDNEEEISASEAREKRGIMAWRCSGASNDELVDNLRASGIVRDH
RVYDAMKSIDRGNFIDVCPYADMPQPLGISSATISAPHMHASALEALKDHLVPGNRVLDV
GSGSGYLTACMAHMVGVRGAGKAEDANTPEGVAVGIDYLPDLVKYSVKKVKAAYPALSKN
PRFKLLVGDGWRGHPELGPYDAIHVGAAASSIPRELLAQLAHGGKMVLPVETTSDGQVVF
EGPEEETERQLSRGRGWWSDRNQVFVEVSKDAQGKVRVKKLMGVMYVPLVKQSSSRGER
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggttcagccacttccaccagggaaaaaatgcgtttgccctcccttccgaatcctcagg
cgtgtggcgacggtgagcttgctcgcggcattcagttcgggtgtatgtacaccgcacgcg
ggtgtctcgcagctttgtaggcaggcagttttggaaaatttaacgtcgatttcctacttt
tttcgtgtgctttcttctgcgagtcgtcttcaaagcaagggcacgacctcctgctctctt
tcgcccttcgcgctggcgcaaaacccagagttacggccttcagaccacactcgcctgcct
tcgtcctcactggcgtgtgccagcgggggcagcgtcgattgcagagcgttctctttgaag
aaggcacacctaaagacggggcttttcgcggcgagaactcgactttttctctcgcctctc
ctccggcacctcttgcagccttcactggtctcgttcctctcttctcccgccaccttccaa
cgtttcctctctgtcgcagaacgaccaggcacgccctcagcatacacgcgacagtcagca
gacagacgcgagcctaggaagacagaaagagaaccggcggcgacctcagcttctcttcct
ctccaccttccttctcgggcgcctcgacgcttcgcccctgtgttgctcccggccacctca
atagtgtcacaacaagagagaggtgaaaatcgggacgaaacgagagaggaacgcagtgaa
gcaggcgaaaagggagaggagagcaagctcgatgcagacgctgaggaaagcgacaatgaa
gaagaaataagtgcgagtgaggcgagagagaagagaggcatcatggcatggcgatgttca
ggcgcaagtaacgacgagctcgtcgacaacctccgagcctcaggaatcgtccgtgaccac
agagtctacgacgctatgaaaagtatcgatcgagggaactttattgacgtctgtccctat
gcagacatgcctcagccgctgggaatttcgtctgcgactatttccgctccccacatgcat
gcctctgctctagaggctctcaaagatcatctcgttccaggaaatagagttctcgatgta
ggctccgggtcaggctacttgactgcatgcatggcccacatggtcggcgtgagaggggcc
ggaaaggcggaggacgccaacactcccgaaggagtggccgtcggaatcgattatcttcca
gatttggttaaatactctgtcaaaaaagtgaaggcggcgtatccggccctgtcgaagaat
ccccgcttcaaacttctcgttggagacggctggcgaggtcatcccgagctcgggccgtac
gacgcgatccacgtcggagccgctgcgtcttcgattcctagggaactcctcgcgcaactt
gcgcatggaggaaaaatggtgcttcccgtggaaacgacgtcggacggccaagtggtattc
gaaggaccagaagaagaaacggaacgccagttgagccgcgggcgcgggtggtggtccgac
cgtaaccaggtgtttgttgaggtgtccaaagacgctcaaggcaaagtccgagtgaagaaa
ctgatgggtgtcatgtatgtgcctctcgtgaagcagtcaagctcacgtggagaaagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system