KEGG   Toxoplasma gondii: TGME49_115150Help
Entry
TGME49_115150     CDS       T01093                                 

Definition
eukaryotic translation initiation factor 4E, putative
Orthology
K03259  
translation initiation factor 4E
Organism
tgo  Toxoplasma gondii
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TGME49_115150
Translation factors [BR:tgo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TGME49_115150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MKEAVAVPLASVEEKERQKLQKKEETEKEVEEKAIEEKKARKKKEILAEDALEEKASWRA
DPVAAPRPRKASDTPPTSPTVAWSSPKAELKKERKLPKNVPSPVLAAKKFGGRERGALPG
RQSHGQIRVKKQNVPAGEHALETGWRFWYYDPAQAVMENLRDATLAAFPETTRVYASRLR
GLSCFSTVEGFFRYMRCLARPSQLPGECLLQLFRKGCWPLWEFFPSGGSWSLRVKKPGCS
ARTVDGLWETLVLACIGETFEMPEVVGVVVQSKAKEFVLSLWIDSCPNAEAQKRIGEKLD
QLCRIRGNLSFQFKSFQMVLKNCGAPPSSPSPAKTPAASPPPSPFLLAASFASLGSSALS
PAVRPGIFSLLKASGEKSADRLVLEPRADDATQEKENGDSSEEESTAQPPEGKQETAANR
ENEKSKETGKKKATKAPGGGGEAEEAPEKKNPREA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggccgtcgccgtccccctcgcgtcagtcgaggagaaggagaggcagaagctg
cagaagaaggaggagacagagaaggaggtggaggagaaggcgatcgaggagaagaaggca
aggaagaagaaggagatcttggccgaggatgcactggaggagaaggcctcgtggcgggcc
gatcctgtcgctgcaccgaggccgcggaaggccagcgacactcccccgacgtcgcccaca
gtcgcatggtcctcgccgaaagctgaactgaagaaagaacgaaaacttccgaagaatgtg
ccatcccccgtcctcgcggccaagaagttcggcggcagagagcgcggcgcattgccgggc
agacagtcgcacgggcaaattcgtgtgaagaagcagaatgtgcctgccggcgagcatgcg
ttggagacagggtggcggttttggtactacgacccggcccaggcggtcatggagaatctc
agggacgcaactctcgccgcgttccccgaaaccacccgcgtctacgcctctcggctccga
ggcctcagctgcttctccacggtcgagggattcttcaggtacatgcgatgtctggcgcgg
ccctctcagctgccgggcgagtgtctccttcagctgtttcggaaaggctgctggccgctt
tgggagttctttccgagcggcggaagctggagtctccgggtgaagaagcctggatgctct
gcccggacggtcgacggcctctgggagacgctggtccttgcgtgcatcggggaaaccttc
gaaatgcctgaggtcgtcggcgtggttgtccagtcgaaagcgaaggagtttgtcctctct
ctctggatcgactcctgcccgaacgctgaggctcaaaagcgcattggagaaaagctggac
cagctttgccgaatccgtggaaatctctccttccagttcaagagcttccagatggtgctg
aagaattgcggagcgccgccgtcttcaccttctcccgcgaagacgccggccgccagtcct
ccgccgtcgccgttcctcctcgccgcgtccttcgcctctctcggttcttctgcgctctcc
cctgccgtccgtccgggcatcttctctctcttgaaggcgagtggagagaagtctgcagat
cggctggtgctggaaccgcgcgcagacgacgcgacccaggagaaggaaaacggagatagt
tctgaggaagagagcaccgcacagccccccgaaggcaaacaggaaacagctgcaaacaga
gagaatgagaagagcaaggagaccggaaagaagaaggcgacgaaagcacctgggggtgga
ggcgaagcagaggaggcaccggagaagaagaatccgagagaggcctga

DBGET integrated database retrieval system