KEGG   Toxoplasma gondii: TGME49_116440Help
Entry
TGME49_116440     CDS       T01093                                 

Definition
phosphatidylinositol 3- and 4-kinase domain-containing protein (EC:4.1.1.70 2.7.11.1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tgo  Toxoplasma gondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2896 aa AA seqDB search
MSVTQVPGLSNLHFTAFVAMARIVRSYLAPQAATGFSGGLLPESSRQEMLDQGVCGDYFA
MPRDAVSQRGSWNQILGGETGSELASQALASILPQFLQTAASLLTASGSTGEQRLAILAT
LGQSPSLYKHTPCPESLAFLDVLSDLLDQRLAELKVQCQHLPHTRAKVPGSPGQQSVFAG
LSTNEPLGDPRPETTSRKSSREVVETFARASRGGVSGTDTSGFSSPAVSVPRRTSLLDMP
VSLPAPMRRGRAEGIAAAFSRRAWDAVCGQAPEKARGIIRGAWNAPLMNSGPSSESDSSA
SDSSLCDESGDLDSTSDELDLTDPYAEVPVEFEPVRWDWWPPDTSSEVEKEIWILLPLLE
IFLMKLPGRITHYSSRAARQLQELLHIRRCCPHTALAERALQTLERCALILRPTVGHQIL
FLAQLCTVPSMSPSSFLVSGEPAAMTHRIAELCCEEQGRVVRRFDWWLINEQKCEPAAGP
LRCRCCCCSAAPLQLRLALLKTLEALMAHCGFPLLLGGTMCRLMSILECADDEGVPTELR
EQVLSVVETIGYLFPKEAEVYVRQLQKAIVASGKPYLPDGSFVGTQPTPSLPASPSSMDY
QASPAFQPAAPQSAVPESPAWIQASRGELVPPGTRKGTDGADYRSSSASPDPRRASDDAH
QRPAGQVVEAPIRILGVPEASSPTRHPARLAWAMGGSETQHPLVDDSESDDSESPFEGHR
SEAEPFLQNRGRASQRQAGVRREGSLQSAWARAHPTFSTLHAVQEMSEIEERLGDSECER
DADAPSEKRACEEPHEDDQCSHKEKPTDGREKRTRQKRYKKHASRRRIEALHSRTSATAH
ELWANCDFKNKRELHCWFRNVSLAMLRECRAPVVRACLPVALQDPSIAASLLSAVFLTYW
ASCCSKGALSQMYQVGRGLRSVLLCPDVTLASLRRVLNLVETIEQQRWPLPVDTQLLAAV
AEKCQANAKAIRYREELWLADPGGSVEALIRLSHETQQLEAARGILAHAQKKLRLPVKEC
WYVQLGEWEQALEAYEQREREDPSNAEWLKGKMRCLRALGEWERLAFLADDLWKDDLAQF
SPPGGTNYTSLRSSSDVSSVQLPSALASSRASCFAASPGGSPATHLHPADPYAQPTPGSQ
ALPLQAYLRESPYEGPSGQSVRASPLSEPSPGRPTQPPQADAREDRRPQNLQSQVAERRR
ETASLAASVAFHFRDWAALERYVQWFPATDSCEHAFYMAVLRVHRGEFEAALEEIQRARQ
LLDPELTALLGESYKRAYPALVTLQQLAELEEIVELLQRQRDRREEGQQPPVAECTGSQS
YSAIHTHDFSASMNYSEPETSRGRRLSDAWKGFQISRSLRRGQRDSDSLGRPEDAGEQRG
PLGRSGAWQQGPRSSDSSRQRYSAGEQEDDIGEEGTASEQLRHLWRTRLATCESNAEIWQ
KLLRVRSLIMSPHEDATTWLRFSSLCRQQHHARLAVEIIQCLRDHPHSRHDPRVVLESFK
VLHAVGRKLEAQLLLTSFCCQFVTTFFNDMPEQLLCAQDSAVPLCVRAANLLEFRAVPSK
VRGLRVAGLSTTPAFSEGFVDSDVCLPSLTPRSEQLLRATGQFELDRNTISALGRREVYR
RFLADVKKTLQRQKDLKRLLPPELVVVKLMEELEERSAPGCAESKVPLGAKDPLGAFSRR
QDTDPVWDRLARGERLLKPTDEQPLPGVLFMEESTTMWRREIFRDGSWYLSLNLCNQAVH
GGLKQWNLGSAAGLTKEEGLRLLSRSLLRLAQWTKDTYNAGQGAPFLLHDVHFHSRRKSG
YSSSCADSSRPRLRSGTSAWKPEVFHGPVHVHASWACNPDALFQILHWQRRGVLFQSRNS
KAWSAWALTNFQVAEALKNVVANEAFPVSKSGQSSFASSSRNSHARGARVSARSEPPELT
DSGSFQEGGSGSRDFAREGRWGREEDDSVHQSLHLDSSSFASHTKRTNSLGSFCCDNRSG
PDDGHHRRQARGSGESHYADSAVLLQQPPLLPKALIDMYDPWEPFTADSPENENHGKPTN
SSAEMSNLHGDTRGKGEALAGNRGKEANRGAPRHRGGDGRQARPERLAENPEETRDVDFC
SPQEADSSRETFRGPAVGSSAADERNEEEKEVLLLTTMLPHFIVEAVRAFLRSIELRPST
SSLQDILRLIKLWFVHADIPVICPLVQHGVSTIPLATWLDVIPQLVGRLITPDSCLRGSV
MNLLSKAAVQFPQELIFPLAVASKSATPHLSSSACVLLNIMARDHRELVQHALLVSEEVV
RVSALWEERWLRCLEQASEAHHTRSDYRKAVALLEPMHEELCRGPQTFRETLFLQKYGRE
LENAYTYLKRFRRSGNRYDVDQCWMFYLPVFTRLLKDTQNLKRLDLKEVSSALSEVKDLK
VAVPGCIGVNGNYPLIRSFLGDVSVFTSKQRPRKIGIMGSDGRVWNFLLKGQDDLTQDER
IMQALRLINHLMESNADARRKELSIPLYSIVPLSPTAGLIGWLQNTETMLTSIKAFRQGE
GIPVNHEQLILNMLYHKYESLTLLQKVDLFEQTSAATSAQALRRVLWLRARNSEEWLLHR
ANFCKSVAVMSMVGYILGLGDRHPSNLLLMGESGRVAHIDFSDCFEVAAYRPRCPEKVPF
RLTRMIVCALESGTVEGTFRATCEQVMSLLRVNQDAIVAMLEAAFVGDVSTARRLHQIFG
SHAQRKLQAKRAVSGPSRFDPSSIEARQRYANGERPFPQTFRRPFEHQFRRGDSARELQS
QGSAWKRQAESDEKAFDPNTSGLVTLSEGEANNVRYRRRNMQHFRRGQRGVGVSEDEFLD
NETGSEHSTDEALSGMEGIQRLQTYTKRVIARVEAKLTGYDFEEYMDVPAQVDSLIEEAN
GVENLCVAYAGWCPFW
NT seq 8691 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgacccaggtccctggtctttccaatctccactttacagccttcgttgcgatg
gctcgcatcgtacgttcgtatttggcgccgcaagcggccaccggcttctcaggcggcctc
ttgccggagagctcgcgacaggagatgctggaccaaggcgtatgcggcgattacttcgcg
atgcctcgagacgctgtgtcgcagcgtgggagctggaaccagatcctaggaggagagact
ggatccgaattggcgtcacaggccctggcctcgatcctgcctcagttcctccaaacagcg
gcctctctcttaactgcgtcaggctcgacaggcgaacagcgtttggcgatcttagctact
ctagggcagagcccgtcgttgtataaacatactccatgtccggagtcgctcgcgtttctc
gatgtgttgtccgacctgttggatcaacgtctggcggagctgaaggtgcagtgtcagcac
ctgccccacacgcgcgcgaaggtgcctggaagccctggccagcaatccgtttttgctggg
ctgtcaacaaatgagccactcggcgaccctagaccggagacgacgtcgcgcaaatcatcg
cgtgaagttgtggaaacgttcgctcgcgcttctcgaggcggcgtctcagggacagacact
tctgggttctcctcacctgcagtttcagttccgcggcgaacatcgctgctggatatgcca
gttagtctgccagcgccgatgcgtcgtggccgggccgaggggattgctgcagctttctcg
agacgtgcgtgggatgccgtctgtgggcaggcgccggagaaagcgagagggattattcga
ggcgcctggaatgcgccgctgatgaactctggtccgtcgagcgaaagcgattcctcggcg
tccgattcgtctctatgcgacgagagcggagacttggatagcacctcagacgagttggac
cttacggacccgtatgcggaggtgccggttgagttcgaaccagtcagatgggactggtgg
cctccggacacgtccagtgaagttgaaaaagagatttggatccttctgcctcttctggag
atctttttgatgaaactccctggccgcatcacgcactacagcagccgagccgcccggcag
ctgcaggaacttttgcatattcggcgatgctgtccacacacggcgcttgcggagcgggca
ctccagactctcgagcgatgcgccttgatcttgcggcccacagtcggccaccaaatcctg
tttcttgctcagctgtgtacggtgccatcgatgtctccgtcgtcctttctcgtttctggc
gaacccgccgcgatgactcaccgtatcgcggagctgtgctgtgaagagcaaggcagagtc
gtgcgccgttttgactggtggctcatcaatgaacagaaatgcgagcccgcggcagggcct
ctccgatgcaggtgctgctgctgttcagccgcgcctctccagctccgcttggctctttta
aaaacactggaagcactcatggctcactgcggcttccctcttctcctcggaggcaccatg
tgccgcctcatgagcattctggagtgcgccgacgacgagggcgttccgaccgagctgcga
gagcaggtcctctctgtggtagagacgatagggtacctctttcccaaagaagccgaggtg
tacgtccgccagcttcaaaaggcgattgtggcttccggaaagccgtacctccccgacggc
agcttcgtggggacacaacctactccttcgctacctgcgtctccgtcttcgatggactat
caggcttcgcctgcgttccagccggcagctccccagtcagcagtgcctgagagtcctgct
tggatccaagcgtcccggggcgagttggtgccgccagggacacgcaaagggactgacggg
gccgactaccgctccagttctgcctccccggatcccagaagggcctctgacgacgcgcat
cagcgccctgctggtcaggttgtggaggcaccgatccgcattctaggggtgccggaagcg
tccagtcccacacggcacccagcgcggcttgcgtgggcgatgggaggctcggaaactcag
catccgctcgtggacgacagtgagtcagatgacagtgaatctcctttcgaagggcaccgc
tcggaggcggagcctttcctgcaaaaccgaggacgggcctcacagagacaagcaggcgtc
cgtcgggagggcagccttcagagcgcgtgggcgcgggcgcatcccacattttccaccctc
cacgcggtccaggagatgtcggagatcgaggagaggctaggcgacagcgagtgcgaaaga
gatgctgatgcaccctcagaaaaacgggcatgcgaggaaccacatgaagatgaccaatgc
tcgcacaaagagaagccaacggatgggcgggaaaagaggacacgacaaaagaggtacaag
aaacacgcaagccggaggaggatcgaagcactacactcgcggacgagcgcgacagcccac
gaactctgggcaaactgcgacttcaaaaataagagggaactgcactgttggtttcggaat
gtctcgttggcgatgctgagggagtgccgcgccccagtcgtgcgggcttgtctcccagtc
gccctccaggaccccagcatcgctgcgtcgctgctctctgcagttttccttacctactgg
gcctcgtgttgcagcaagggtgctctcagtcagatgtaccaagtggggcgcggtttgcga
agtgttcttctctgccccgacgtcacgctcgcctctcttcggcgagtgctgaatctcgtg
gaaacgattgagcagcagcgctggccgttacctgtggacacacaactactcgctgcagtc
gccgaaaagtgccaggcgaatgcaaaagcgattcgatatcgggaggagctttggctagcc
gacccaggaggctcggtcgaagcgctgatccgtctgagtcacgagacacagcagctggag
gccgcccgcggcatcctggcgcatgcacagaagaaactgcgcttgccggtgaaggagtgc
tggtacgtccagctgggagagtgggagcaggccctggaggcctacgagcaacgagagcga
gaagacccaagcaacgccgaatggttgaaaggcaaaatgcggtgcctgcgcgctctcggc
gagtgggaacgactggcttttctggctgacgacctgtggaaagacgacctcgctcagttc
tctcctcccggtggcaccaactatacctcgctgcgctccagctccgatgtgtcgagcgtg
caattgccttctgccttggcttcctcgcgagcctcgtgcttcgctgcttctccagggggc
tcccctgcaacccacttgcaccctgcggacccctatgcgcagccgacccccggatcgcag
gcgttacctttacaggcgtacttgagagagtcgccatacgaagggccttcgggccagagt
gtccgcgcgtcgcccctgtcggaaccgtctccgggtcgccccacacagccgccccaagca
gacgcgagggaggacaggcggccacagaacctgcagagccaagtggcggaaaggcgccga
gagacagccagcctggctgcatcagttgccttccatttccgcgactgggcagcactcgaa
cgctatgtccagtggttcccggctacggattcgtgtgaacatgcgttctacatggccgtt
ctgcgtgtccatcgcggtgagtttgaggccgcgctggaggagattcagcgtgcgcggcag
cttctcgacccggagctgaccgcgctgctcggagagtcctacaagcgagcgtatccagct
ttggtaactttgcagcagctggcggaactcgaggagatcgtcgaactgcttcagcgccag
cgagacagacgtgaagaagggcagcaaccacccgtcgccgagtgcactggcagccagagc
tattcagcaattcacacgcacgacttttcagcgtcgatgaactactcagagccggagacc
agcagaggcaggcgcctgtcggatgcttggaaaggtttccagatttctaggtctcttcgc
aggggccagcgcgacagcgattcacttggccggcctgaggacgccggtgaacagcgaggg
cctctagggcgctctggcgcgtggcagcaaggcccccgaagcagcgacagttcgcgacag
cggtattcggccggcgagcaagaggatgacatcggtgaagaaggcacagcctcagagcag
ttgcgacacctgtggcgcacccgcctcgcgacctgcgagtccaatgccgaaatctggcag
aagctgctccgggtccgttcgctcatcatgtcaccacacgaagacgcgacgacgtggctg
cggttctcttcgctttgtcggcagcagcaccacgcgcgtctggctgtggaaattatccag
tgtctgcgggaccatccgcactcgcgccacgaccctcgagtggttctggagtctttcaag
gtgcttcacgcggttgggcgcaagctggaggcgcaactgcttctcacgagtttctgctgt
cagttcgtcacgactttcttcaacgacatgccggagcagcttctctgcgctcaggactcg
gccgtgcctctgtgcgtgagagcggcgaacctgctcgagtttcgtgcagtgccgtcgaag
gttcgcggccttcgcgttgcgggtctgagcacgacgcccgctttctctgaaggttttgtt
gactcggacgtttgcctgccgtcgctgaccccccgaagcgagcaacttttgcgcgcgacg
ggccagttcgagttggacaggaacacgatctccgctctgggccgtcgcgaggtgtacagg
cggtttttggccgacgtgaagaagacgcttcagcgccagaaggacctaaagcgcctgctc
ccgccggaacttgtggtcgtgaagctcatggaagagttggaagaaagaagcgcaccgggg
tgcgcagaatccaaggtcccgctgggcgccaaagaccctcttggagccttttctcgacgc
caagacaccgaccctgtctgggatcgcctggcgcgcggtgagcgcctcttgaagccgact
gacgagcagcctctccctggcgtgctgttcatggaggaatcgaccacgatgtggaggaga
gagatcttccgagatggcagctggtacctctctctgaatctgtgcaaccaggcggtccac
ggcggcctcaaacagtggaatctcggttctgccgcagggttgaccaaggaggagggccta
cgccttctttcgcgcagcctcttacgtctagcccagtggacgaaggacacctacaacgct
ggccaaggcgcgccgttcttgttgcacgacgttcacttccactctcggcggaaatcgggt
tactccagcagctgcgcagatagctcgcgtccacgcctccgatcggggacttctgcgtgg
aagcccgaggtgtttcatggccccgtacatgtgcatgcgtcgtgggcgtgcaatcccgac
gctctctttcagattctccactggcagcggcgaggggtattgtttcagagccggaactcc
aaggcctggtctgcatgggctctgacaaatttccaggttgcagaggcgctgaagaacgtc
gtcgcgaacgaagcgttccccgtctcgaagagcgggcaatcgtccttcgcctcttcgtcg
aggaactcgcacgcgagaggtgcccgcgtctcagctcgatccgagcctccagaactcacc
gactcgggatcttttcaggagggtggatctggaagccgcgacttcgcgcgcgaggggcgc
tgggggagagaagaagatgattcagttcatcagagcttacatctcgactcttcttctttc
gcgtctcacacgaagcggactaactcacttggtagcttctgctgcgacaaccgatctggc
ccagacgacgggcaccaccgccgccaggctcggggctcaggagagagccactacgcagac
agtgcggtgttgctgcagcagccgccactgcttcccaaagccttgatcgacatgtacgac
ccctgggagccctttactgcagactcgccggagaacgaaaaccatggcaagcccacgaat
tcgagtgcagagatgtcgaacctccacggtgacacccgaggaaagggagaggcgcttgct
gggaaccgtggaaaggaggccaatcgcggggcaccaagacaccgtgggggggacgggcgg
caagcccgtccagagcgactggcggagaacccagaggagacacgagatgtggatttctgc
tcaccccaggaagcagacagcagccgagaaactttcaggggaccggcagtgggaagctct
gcggctgacgaacgcaacgaggaagaaaaagaggttctgctgctcaccaccatgctcccg
cacttcattgtggaagcggtgcgcgccttcctacggtccatcgaactccgcccttccact
tcgagcctccaggacatcctgagactcatcaaactttggtttgtgcatgcggacatcccc
gtcatctgccccttggtccagcacggcgtgagcacgatccctttagcgacgtggctggac
gtaattccgcagctcgtggggcgcctgatcacgccggattcgtgcctgcgaggctcggtg
atgaatcttctcagcaaagcagctgtccagtttcctcaggagctgatctttccattggcc
gtggcaagcaagagtgcgacgccacatctctcttcgtccgcatgcgtcctgttgaacatc
atggctcgcgaccaccgtgaacttgtccagcatgcgttgctggttagcgaagaagtcgtc
cgggtttcggccctctgggaggagcgatggctgcggtgtctcgagcaggcgagcgaggcg
caccacacacggagcgattatcgaaaagccgtggcgctgctggagcccatgcacgaagaa
ctgtgcaggggtccccaaactttcagagaaacactgttcctgcaaaagtacgggcgggag
ttggaaaacgcgtacacgtacctcaagcgtttcaggagaagcggcaaccgctacgacgtg
gaccagtgctggatgttttacttgccggttttcacgcgactgctcaaagatacgcagaac
ttgaagcgtctggatctcaaagaagtctcttccgctttgtctgaagtgaaagacctgaaa
gtcgcggtgcctggctgcattggagtcaacggcaactatccgttgattcgatctttcctc
ggagatgtttccgttttcacgtcaaagcaacgacctcgaaagatcggaattatgggaagc
gacgggcgtgtctggaactttcttctaaagggccaggatgacctgacacaagacgagaga
atcatgcaggctcttcgcttgatcaatcacctgatggagagcaacgcggacgcgcggcgg
aaggagctgtccattccgctctacagcatcgttccactgtcacccactgcaggtctcatt
ggctggctgcaaaacaccgaaacgatgctcacgtcgattaaggccttccgacagggtgaa
ggcatccctgtcaatcatgagcagctcatcttgaacatgctctatcacaaatacgagtct
ctgacgcttcttcagaaggtggacctcttcgagcaaacatcggctgcgacgagtgcgcag
gcgctgcggagggttctgtggctgcgggcacgaaacagcgaggagtggctgcttcaccga
gcgaacttttgcaagagcgttgcggtcatgtctatggtagggtatatcctggggcttgga
gaccggcacccgtcgaacctgcttctcatgggagaatctgggcgcgttgcccacatcgac
ttcagcgattgcttcgaggtcgccgcgtacaggccacgctgcccggaaaaggtccccttt
cggttaacgcgcatgattgtctgcgctttggagagtgggactgtcgagggaacattccgg
gcaacctgcgagcaagttatgtctcttctacgtgtgaaccaagacgcgattgttgcgatg
ctcgaggcagcgtttgtcggggacgtctcaacagcccgtcgcctacaccaaatttttgga
tcgcatgcacagcggaaattgcaggccaagcgcgctgtgtccgggccgtctcgattcgat
cccagctcgatagaagccagacaacggtacgccaacggagagagacctttcccacagact
ttcaggaggcccttcgagcatcagttcagacggggagacagcgcccgggagctccaatcg
caaggtagcgcttggaagcgacaggcagaaagtgatgaaaaagcatttgatcccaacact
tccggccttgtgacattgagtgaaggagaagcaaacaatgtgagatatcggcgaagaaac
atgcagcactttcggcgtggccagcgtggcgtgggcgtgagcgaggacgagttcttggac
aacgaaaccggatccgaacacagcacggacgaagcgttgagtggcatggaaggcatccag
cgactccagacctacacgaaacgggtgatcgcgcgcgtagaggccaagctcaccggctac
gacttcgaagaatatatggacgttccggctcaagtagacagcctcatcgaggaagcgaac
ggagtggagaacctgtgtgtggcctacgccggctggtgcccgttttggtga

DBGET integrated database retrieval system