KEGG   Toxoplasma gondii: TGME49_116520Help
Entry
TGME49_116520     CDS       T01093                                 

Definition
1,4-alpha-glucan branching enzyme, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tgo  Toxoplasma gondii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TGME49_116520
Enzymes [BR:tgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TGME49_116520
Exosome [BR:tgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TGME49_116520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 972 aa AA seqDB search
MEKAKVFRTVEKQHEEEYAAVQRSSGVDCVPGKYLPSAGPKEPPHTNMFDCAVAADSPRG
SSLDVVGGLRCGAARGHGRCMGDGAETDGAKGTSDEVREEAGAPAKGEGRRSVKYVGVPL
KDLPQGSSLSEHDVHLLHKAHHGDPFGVLGCHEVKGGQKEKILIVRAWIRNAKTIRLRAL
ECSECVVATEEPVPMEKRADFLFQKAFVVHRLASEKETASSPCKATQSKPGEILESDDSP
VTFKYELLCVYEGDETNEERVAHDTYNFGVLLPRFDLELFQSGSCWHVDNLMGSHMLTVE
GIRGVRFAVWAPSACFVSVVGDWNAWDGRAHPMRRRVEFGVWELFVPDIGAGEKYGYRIH
TRGGLDVIKIDPYAQEFEIPPKTASIISACDDAFRKPEERFVWNDQAWMSRRKQLGEEDL
LRRQPMAIYEVHLPSWMRGDNNTYLSYRELADRLVRHVKTMNFTHVEFLPLAHHPFEGSW
GYQVTGLYAPYSRLGSPDDFKYLVDKLHQSGIGVFLDFVPAHFCKDSWGLARYDGEPCYE
YADPREGEHKMWGTLVFNFRRSEVRSFLLGAAYHWLRRYHIDGLRIDAVSSMLYKNHQRE
PGDWLPNEFGGDANLQAMSLLQELNWVVHQEFPGVFTMAEESTSWQGVTDKEKGLGFDAK
WDLGWMNDTLSYLCLPLYKRPEPACHNKLTFRGLYMAHEKWILPLSHDEVVSGKGSLLDK
CGFAGSPFEDRIKTLKTLFGYQVGSPGRPLIFMGAEIGQGREWKDNRSVDWHEGEEELRK
KLCIWVSDLLAVYVHHKALHAGDDEPWNFKWTDCDNSKDCVIAFLRSYMDWYNDILVVCN
FSPNVYYRYPIGVPHGGEWEVILNSDDWRYAGGMVGPGNLSRVHTTQGGRLGWPYCLWLD
LPPFGCLYIKSPQPQPEVKGLDSAEKKKVAKEDPPANTNGDIGKTDKRTEKLNGAEEERT
AVDSGNGNLEAS
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggcgaaggtttttcgaacggtggagaagcagcacgaggaagagtacgctgca
gttcagcgctcctccggtgtcgactgcgtcccggggaagtacctgccttccgccggcccg
aaggagccgcctcacacgaacatgttcgactgcgccgtcgccgcagattccccgcgcggg
agctctttggacgtcgttggaggcctccgttgcggagcggctcgtggacatggccgctgc
atgggcgacggcgccgagaccgacggcgccaaggggacatccgacgaggtccgcgaggag
gcaggcgcccctgcaaaaggagaaggccgtcgaagcgtcaagtacgtgggtgtgccactg
aaggacctcccccaaggctcctcgttgtccgaacacgacgtccaccttctgcacaaagct
caccacggcgaccctttcggcgtcttgggctgtcacgaagtgaaaggcgggcagaaggaa
aagatcctcattgtcagagcctggattcgaaatgccaagaccattcgtctgagggccctt
gagtgctccgagtgtgtggtggccactgaggagccggtgccaatggagaaacgcgcagac
ttcctcttccagaaggccttcgttgtccaccgtctcgcctcagaaaaggagacagcgtcg
tcgccctgtaaggcgacccagtcgaagcctggggagatcctggagagtgacgactctcct
gtgacattcaagtatgagctcctctgtgtatacgagggagacgagacgaacgaggaacgc
gtcgcccacgacacttacaacttcggcgtccttcttccgcgctttgacctcgaacttttc
cagtctggttcatgttggcatgtcgacaacttgatgggttcacacatgttgacggtggaa
ggcattcgcggcgtccgcttcgcagtgtgggcgccgagcgcctgcttcgtgagcgttgtg
ggagactggaacgcctgggatggccgcgcacacccgatgaggcgaagagtcgaattcggc
gtttgggagctgttcgtgcctgacatcggcgcaggcgaaaagtacggctaccgcatccac
acacgaggcggcctcgacgtcatcaaaatcgacccatatgcacaagagttcgaaatccca
cccaaaaccgcgagcatcatcagtgcatgcgatgacgcatttcgcaagccggaggagcgc
ttcgtgtggaatgaccaggcgtggatgtctcggaggaagcagttgggggaagaagatctt
cttcgcagacaacccatggcgatatacgaagtgcatctccctagctggatgcgtggcgac
aacaacacttacctttcttatcgagaactcgcagaccggctcgtgcgccatgtgaaaacc
atgaacttcacacacgtagagttcctgcctctcgctcaccatcccttcgaaggctcttgg
gggtaccaggtcacaggtttatacgcgccctacagtcgcctcggaagtcccgacgacttc
aagtacctcgtggacaagctgcatcagagcgggatcggcgtcttcctcgatttcgtcccc
gcacatttttgcaaagactcctggggcttggctcgctatgacggagagccctgctatgaa
tatgcagaccctcgtgaaggcgaacataaaatgtggggaactctcgtcttcaactttcgg
cgaagcgaagttcgctcttttctgttgggagctgcgtaccactggctgcggcgctaccac
atagacggcctgcgcatcgacgccgtctcttcgatgctgtacaaaaaccaccagagagag
ccgggcgactggctgccgaacgagttcggcggagacgcgaatctgcaggccatgtctctc
ctccaagagctcaactgggtcgtccaccaagagtttccgggcgtcttcacgatggctgaa
gagagcaccagctggcaaggcgtcactgacaaggaaaaaggcctcggcttcgacgccaaa
tgggatcttggatggatgaacgacacgctgagctacttgtgtctgcctctctacaagaga
ccagagccagcttgtcacaacaaactgactttccgagggctgtacatggcacacgaaaag
tggattctcccgctgtcgcacgacgaggtggtcagcggaaagggctctctgctggacaag
tgcggttttgcaggcagtccgtttgaagatcgaatcaaaacgctgaagacactgttcggg
taccaggttggatcccccggccgacccctcatcttcatgggcgccgaaatcggacaagga
agagagtggaaagacaacaggtctgttgactggcacgaaggcgaagaagaacttcgaaag
aaactgtgcatttgggtttccgacctcttggcggtatacgtccatcacaaggcgctgcat
gcgggagacgacgagccgtggaacttcaagtggaccgactgcgacaatagcaaagactgt
gttattgccttcctccgatcctacatggactggtacaacgacatcctggttgtttgtaac
ttctcgccgaatgtctattaccgctaccctatcggagtcccgcacggtggagagtgggag
gtcatcttgaactctgacgactggagatacgcgggcggcatggtcggtccgggaaatctt
tcgcgagtccacaccactcaaggcggacgacttggctggccgtactgcctatggctcgat
cttcctccattcggttgcctgtacatcaagagtccacagcctcagccggaggtgaaaggg
ctggattctgcggagaaaaagaaagttgcgaaggaggacccacccgcgaacacgaatggc
gatataggaaaaaccgacaagcggacagaaaagttgaacggcgcggaagaagagagaacg
gctgtggatagcggcaacggcaacctggaagcatcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system