KEGG   Toxoplasma gondii: TGME49_117000Help
Entry
TGME49_117000     CDS       T01093                                 

Definition
acetylcholinesterase, putative (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
tgo  Toxoplasma gondii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tgo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TGME49_117000
Enzymes [BR:tgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     TGME49_117000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 163 aa AA seqDB search
VFDEDCLALNMWVPEKHDGKVMVWIYGGGFYSGSPSLDLYDGRVLASRQKTIVVNINYRL
RPFGFLYFGSRSSIPGNMGLMDQQLALRWIYENIASFGGDPNKITLFGESAGAASVTAHF
FAPGSSRYFQRAVLMSGTIANSWAIKEKNMALQTSMFLAEKLN
NT seq 490 nt NT seq  +upstreamnt  +downstreamnt
gtatttgatgaggattgcttggcgctgaatatgtgggtaccagagaaacatgacgggaaa
gtaatggtttggatttatggcggtggcttctattctggctcaccatcgttggatctttat
gatgggcgagtgcttgcaagtcgtcaaaagacaatcgtcgttaacattaattacaggcta
agaccgtttggtttcttgtactttggaagcagatcatcaatacccggtaacatgggccta
atggatcagcaacttgctttgcgatggatttatgaaaatattgcctcatttggtggtgat
ccaaataagataacattgttcggggaaagcgcaggtgcagcatccgtgacagctcatttt
ttcgcacccggaagctcccgttatttccagagagcagtgctcatgagcggtacgatagca
aattcatgggccataaaagagaagaatatggcactgcaaacatctatgtttttggctgag
aaattgaatt

DBGET integrated database retrieval system