KEGG   Toxoplasma gondii: TGME49_118560Help
Entry
TGME49_118560     CDS       T01093                                 

Definition
3-methyl-2-oxobutanoate dehydrogenase (lipoamide) kinase, putative (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
tgo  Toxoplasma gondii
Brite
Enzymes [BR:tgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.4  [3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase
     TGME49_118560
Protein kinases [BR:tgo01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   TGME49_118560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 432 aa AA seqDB search
MLRGQQSRCSLSRPDSPRRLAKVRDHSLVECSSIECAHTSFCAAKRPLSLLAHRRRGGKD
EQHAYSAHDDQTPAPAGTCKRRLAPQRVTWIREELPVRLSHRLYDFHRLPFVAVTNPLVH
SVYETYLKTFDRMRRLPPLKTVADMNAFVQLVEKERSTHDRTVDLMGQGVRQLRRICRDV
DLNSFLERFFYFRIGRRVMIDQLVHLQSKQEGWQGIIHLNCHAAKIIEQRSKDVRESCRH
SYGLAPRVVISGNTDMKFATIPDHLALIVTEVLKNALRATVEFHTMGNSLVDATTRGLIQ
EDEDLPEVKVEVYKGKREVVIKISDKGGGVPPPKLQDIWSFGYSTVGDSNTKMQENSSGL
GENFIRSDMAGYGFGLPLARAFARYFGGDIHVQSHFGIGTDVYITLNHIGDKEEALYYEE
RPELRLEHKAPG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggtcagcagtcgcgctgttcactctcgcgcccagactcaccacggagactc
gcaaaagtcagagaccactccctcgtggagtgctcatcgatcgagtgtgcacacacctct
ttctgtgccgcaaaacgccctctctcactcctggcacaccgtcgccgtggtggaaaagat
gagcagcacgcctattcggcccatgacgatcaaacgcctgctccagctggaacctgcaaa
cgacgcctcgctcctcagagggtaacctggattcgagaagaacttccagtgcgtctatcc
caccggttgtacgacttccaccgtctgccgtttgttgcggtgacaaatcctctcgtccac
tctgtgtacgaaacgtatctgaagacgtttgaccgcatgaggcgtcttccgcctctcaaa
acggttgccgacatgaatgcctttgtccagcttgtcgagaaggagagatcaacacatgat
cggacagttgacttgatggggcagggagtgcggcaacttcgtcgcatttgccgagatgtc
gatttgaattccttcttagagagattcttctactttcgaatcggcaggcgggttatgatt
gaccagttggttcacctccagagcaaacaggaaggatggcaaggcatcatccacttgaac
tgtcacgccgccaaaatcatcgagcagagaagcaaggacgtgcgcgagtcgtgtcgccac
tcttacggcctcgctccccgtgttgtcatttcaggaaacaccgacatgaaattcgcaacg
attcctgaccatctggctctgattgtcacggaggttttgaagaacgcacttcgcgcgacg
gtggagttccacacgatgggaaattctctcgtcgatgccacaacacgaggcctgatccag
gaagacgaagacctgcctgaagtgaaagtcgaggtctacaagggaaaacgagaagtcgtc
atcaaaatctccgacaaaggcggcggcgttcctcctccaaagctgcaggacatttggagc
tttgggtacagcaccgtgggagacagcaacacgaagatgcaagagaattcttctggcctc
ggcgaaaacttcattcgctccgatatggctggctatggcttcggtcttccgctggcgcgg
gcgttcgctcgctatttcggaggagacattcacgttcagtcgcatttcggcatcggaaca
gacgtgtacatcacgttgaatcatatcggagataaagaagaggcattgtactacgaggag
cgccccgaactgcgtttggaacacaaagcgccaggctag

DBGET integrated database retrieval system