KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0028Help
Entry
Tgr7_0028         CDS       T00840                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tgr7_0028
Enzymes [BR:tgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tgr7_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(27066..27884)
Genome map
AA seq 272 aa AA seqDB search
MSQPQQQAVIGPLKGAGVLVTRPAHQAEVFCRMIEQAGGVPLRFPVLEILEPRDSGRLDA
LIDRLDAFDIAIFISPNAVSMAVNRIHARRPWPEHLRIGAVGQKSAQELARAGHPAHICP
PRRFDSEALLEEPELQDVAGKRIVIFRGDGGRELLGDTLKERGAVVEYAEAYRRGRPDAD
TGKLMIHWSRGELHLVTSTSSEGLRNLFDMVGKLGRMWLRKTPLLVGAPRMVETARELGF
NGDPWVAEDPSDESMMQAVLQWAQAREPQHEQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccccagcagcaggccgtgatcgggccgctcaagggtgccggcgtgctggtg
acccgcccggcccaccaggccgaggtcttctgccgcatgatcgagcaggccggaggcgtg
cccctgcgcttcccggtgctggagatcctggagccccgggacagcggccggctggacgcc
ctgatcgaccgactggacgcgttcgacatcgccatcttcatcagccccaacgccgtgtcc
atggccgtgaaccgcatccatgcccgacgcccctggccggagcatctgcgcattggcgcc
gtgggccagaagtccgcccaggaactggcccgggccggacatccggcccacatctgtccg
ccccggcgtttcgacagcgaggccctgctggaagaacccgaattgcaggacgtggccggc
aagcgcattgtgatctttcgcggcgacggcggacgcgaactgctgggggatacgctaaaa
gaacggggagcggtggtggaatatgccgaagcctaccggcgcggccgccccgatgcggac
acgggcaaactcatgatccactggtcccggggcgaactgcacctggtgaccagcaccagc
agcgagggcctgcgcaacctgttcgacatggtgggcaagctgggccgcatgtggctgcgc
aagacgccgctgctggtgggcgcgccgcgcatggtggagacggcacgggaactgggcttc
aacggcgacccctgggtggccgaggaccccagcgatgaatcgatgatgcaggcagtgttg
caatgggcacaggcccgggagccgcagcatgagcaatga

DBGET integrated database retrieval system