KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0078Help
Entry
Tgr7_0078         CDS       T00840                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_0078
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tgr7_0078
  Amino acid metabolism
   00310 Lysine degradation
    Tgr7_0078
Enzymes [BR:tgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tgr7_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(76753..77991)
Genome map
AA seq 412 aa AA seqDB search
MSTDVKIPELPESVADATIVSWHKKAGDAVSRDEILLDIETDKVVLEVPAPEDGVIEEIL
AAEGETVTAGQVVGRLGAGAGAGAGAGKSEAPKPTAGKAEAANARGETPPLSPAVRKLVA
EHDLDASAIRGTGKDGRILKEDVLSHLEQQESQAKPAAEKPSAPTAQPPAASSPAPLPGQ
RTERRVPMTRLRARIAERLLEVQHNAAILTTFNEVNMAPVMEMRATHKDAFEKRHGVRLG
FMSFFVRAATEALKRFPEVNASIDGRDIVYHGYFDIGIAVSSPRGLVVPVLRDTDTLSMA
GVEKAINAFGEKAKSGGLTMDDLTGGTFTISNGGVFGSLLSTPIINPPQSAILGMHKIQE
RPVAENGQVVIRPMMYLALSYDHRLIDGREAVQFLATIKGLLEDPAKLLLDV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacgtcaagatccccgagctgcccgaatccgtggcggatgccaccatcgtc
agctggcacaaaaaggccggtgatgccgtgagccgcgacgagatcctgctggacatcgag
accgacaaggtggtgctggaggtgccggctccggaggatggcgtgatcgaggagatcctc
gccgccgaaggcgagaccgtcaccgccggccaggtggtggggcgcctaggggccggggcc
ggggccggggccggggccggcaaatccgaagcacccaaaccgaccgcaggcaaggcggag
gcggccaatgcgcgcggtgagaccccgccgctcagccccgcggtgcgcaagctggtggcc
gaacatgatctggatgccagcgccatccgcggcacgggcaaggacgggcgcatcctcaag
gaggacgtgctcagtcacctggaacaacaggaaagccaggcgaaacccgctgcggagaaa
ccgtccgcgccgacagcccagccgcccgcggcatcttctcccgccccgctaccgggtcag
cgcaccgagcgccgcgtgcccatgacccgactgcgcgcacgcatcgccgagcgcctgctg
gaggtgcagcacaacgccgccatcctcaccaccttcaacgaggtgaacatggcgccggtg
atggagatgcgcgcgacccacaaggatgccttcgagaagcgtcacggcgtgcgcctgggc
ttcatgtccttcttcgtgcgcgccgccaccgaggcgctcaagcgcttccccgaggtgaac
gcctccatcgacggcagagacatcgtctaccatggctacttcgacatcggcatcgccgtg
tcctcgccccggggcctggtggtgccggtgctgcgcgacaccgacaccctgtccatggcg
ggcgtggagaaggccatcaatgccttcggcgagaaggccaagtccggcggtctgaccatg
gacgacctcaccggcggcaccttcaccatctccaacggcggcgtgttcggctcgctgctc
tccacgcccatcatcaatccgccccagagtgccatcctgggcatgcacaagatccaggag
cgcccggtggctgaaaatggtcaggtggtgattcgccccatgatgtacctggcgctctcc
tacgaccaccgtctcatcgacggccgcgaggccgtgcagttcctggccaccatcaagggc
ctgctggaagacccggcgaagctgctgctcgacgtctga

DBGET integrated database retrieval system