KEGG   Thioalkalivibrio sulfidophilus: Tgr7_0094Help
Entry
Tgr7_0094         CDS       T00840                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tgr  Thioalkalivibrio sulfidophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
101262..102617
Genome map
AA seq 451 aa AA seqDB search
MSEDEQRKLKYLDVIRELERELDQRREAETALRKLAERLGRCAQGRSPVLDQALGEIISS
LGTQLEPARVEALTARLQTALRDVDLPDAPPSSSLDDAPDPSRAATAAPTAFLEALQDRL
PAVPGLRGELESLIERLERDQAPADWGLMLNGVANVLKEQCLRAQRERHELESFLKEITD
RLGEFDAYLTGQNNDMDASRQEGVSLETRIQGEVRELQTGMARVGSLDELRTMVSLRLDA
IGDHVRSFREADERRCEDYRTRAERMRARIVQLEHEAQGLRRTMDDERKQALIDQLTGVP
NRQAFDERLAQEYSRWKRFNTPLALIMWDVDRFKLINDSYGHKAGDKVIRAVAQKLKERI
RETDMVARYGGEEFVMLLTGASGQDALAIAEKIRAEIAGLGFHFRGERVPITISAGIALF
AEGDTPETAFDNADRALYEAKNTGRNRCVLH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagacgagcagaggaagctgaagtacctggacgtgatccgcgagctggagcgc
gagctggaccagcgccgcgaggccgagaccgccctgcgcaagctcgccgagcgactgggc
cgctgtgcccagggccgttccccggtcctggaccaggccctcggcgagatcatctcatcc
ctcggcacccagctggagcctgcccgggtggaggcactgaccgcgcgcctgcagacggcg
ctcagggatgtggatcttcccgatgcaccgccatcgtcttccctggacgatgcccctgac
ccctcacgggccgccaccgcggccccgacggcattcctcgaagccctgcaggatcgtctg
ccggcggtgcccggcctgcgcggcgaactggagagcctgatcgaacgcctggagcgggat
caggcgccggcggactgggggctgatgctgaacggcgtggccaatgtgctcaaggagcaa
tgcctgcgcgcccagcgggaacgccacgagctggaatccttcctcaaggagatcaccgac
cgtctgggcgagttcgacgcctacctgaccggacagaacaacgacatggatgcgtcgcga
caggaaggagtgtcgctggagacccgcatccagggcgaggtgcgcgagctgcagacgggc
atggcccgggtgggcagcctggacgaactgcgcaccatggtctccctgcgcctggatgcc
atcggcgatcacgtacgcagcttccgggaggccgatgagcgtcgctgcgaagactaccgc
acccgggccgagcgcatgcgcgcacgcatcgtgcagctggagcatgaggcccagggtctg
cgccgcaccatggatgacgagcgcaagcaggcgctcatcgatcagctcaccggcgtgccc
aaccgccaggccttcgacgagcgtctcgcccaggaatacagtcgctggaaacgtttcaac
acgccgctggcgctgatcatgtgggacgtggatcgcttcaagctcatcaacgactcctat
ggccacaaggcgggtgacaaggtgatccgcgccgtggcgcagaagctcaaggagcgcatc
cgggaaaccgacatggtggccagatacggcggagaggagttcgtcatgctgctcaccggc
gcaagcggtcaggatgcgctggccatcgctgaaaagatccgcgccgagatcgccggactc
ggttttcatttccgcggcgagcgcgtccccatcaccatctccgccggcatcgccctgttc
gccgagggagacaccccggagaccgccttcgacaatgccgaccgcgccctgtacgaggcg
aagaacaccggacgcaaccgctgcgtgttgcattga

DBGET integrated database retrieval system