KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0118Help
Entry
Tgr7_0118         CDS       T00840                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tgr7_0118
Enzymes [BR:tgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tgr7_0118
Exosome [BR:tgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tgr7_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
128029..129033
Genome map
AA seq 334 aa AA seqDB search
MHPYPGYFSMARPRRMRRDDFSRRLMREHQLSCNDLIQPVFVLEGKERREPVPSMPGVKR
LSIDLLLREAEACARLGVPAMALFPVTPPEAKSEDAAEAFNPEGLAQRAVRALKQAVPEL
GVITDVALDPFTTHGQDGLIDETGYVMNDETVEVLIQQALSHAEAGADVVAPSDMMDGRI
GAIREALEEAGHIHTRILAYSAKYASSFYGPFRDAVGSAANLGAGNKYTYQMDPANSDEA
LREVALDLEEGADMVMIKPGLPYLDIVRRVKESFGAPTFVYQVSGEYAMLKAAAQNGWLD
ERACVLEALTSMKRAGADGILTYYARQVAEWIKE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcatccctatcccggttatttctccatggcacggccgcgtcgcatgcgccgcgatgat
ttctcccggcgcctgatgcgcgagcatcagctgagctgcaacgacctgatccagccggtg
ttcgtgctggagggcaaggagcgccgtgagccggtgccgtccatgcccggtgtgaagcgc
ctgtccatcgatctgctgctgcgcgaggcggaggcctgcgcccggctcggcgtgcccgcc
atggccctgttcccggtcacgccacccgaggccaagagtgaggatgccgccgaggccttc
aaccccgagggcctggcccagcgggcggtgcgggccctgaagcaggcggtgccggagctg
ggcgtgatcaccgacgtggccctggaccccttcaccacccacggccaggacgggctgatc
gacgagaccggctacgtcatgaacgacgagaccgtggaggtcctgatccagcaggccctg
tcccacgccgaggccggcgccgacgtggtggccccctcggacatgatggacgggcgcatc
ggcgccatccgcgaggccctggaagaggcgggccacatccacacccgtatcctggcctac
tccgccaagtacgcctccagcttctacggcccgttccgggacgcggtgggttcggccgcg
aacctgggcgccggcaacaagtacacctaccagatggatccggccaacagcgacgaggcc
ctgcgcgaggtggccctggacctggaggaaggcgccgacatggtcatgatcaagccgggc
ctgccctacctggacatcgtgcgccgggtgaaggagtccttcggcgcgcccaccttcgtc
taccaggtgagcggcgagtacgccatgctcaaggccgcggcccagaacggctggctggac
gagcgcgcctgcgtgctggaggcgctgaccagcatgaagcgcgccggcgccgacggtatc
ctcacctactatgcccgccaggtggcagagtggatcaaggagtag

DBGET integrated database retrieval system