KEGG   Thioalkalivibrio sulfidophilus: Tgr7_0123Help
Entry
Tgr7_0123         CDS       T00840                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Tgr7_0123
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Tgr7_0123
    3.5.1.-  
     Tgr7_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
133067..133633
Genome map
AA seq 188 aa AA seqDB search
MSKPEFQPGDALLLVDVQIDFCPGGALPIEEGDQVVPVLNRYIDAAVARGVPVYASRDWH
PAGHPSFKDQGGPWPVHCLQDSEGARFHPDLCLPQDTILITKGTRFDQDQNSAFDQTGLA
TELRRRQIRRLWVGGLAEDVCVAATVRDALDEGFDVLLIGAGTRPVTVEGGQQARRRMSA
SGAHVVDA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacccgaattccaacccggcgacgccctgctgctggtggatgtgcagatcgat
ttctgccccggcggcgccctgcccatcgaggagggtgaccaggtggtgccggtgctcaac
cgctacatcgatgcggcggtcgcccggggtgtgccggtctacgcctcccgggactggcac
ccggcagggcacccgagcttcaaggaccagggtggcccctggccggtgcactgcctgcag
gatagcgagggggcgagattccatcccgacctgtgtctgccgcaggacacgatcctgatc
accaagggcacgcgcttcgatcaggaccagaactccgcttttgatcagaccggcctggcc
accgaactgcgccgtcgccagatccggcgcctctgggtgggcggcctggccgaggacgtg
tgcgtggcggcgacggtgcgcgatgccctggatgaaggcttcgatgtgctgctgatcggc
gcaggcacgcggccggtcaccgtcgagggtggacagcaggcgcgccgccgcatgtcagcc
tcgggcgcccacgtggtggatgcgtga

DBGET integrated database retrieval system