KEGG   Thioalkalivibrio sulfidophilus: Tgr7_0184Help
Entry
Tgr7_0184         CDS       T00840                                 

Definition
aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain-containing protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tgr7_0184
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tgr7_0184
Enzymes [BR:tgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tgr7_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201454..202542
Genome map
AA seq 362 aa AA seqDB search
MVETNDAQLDRPLQPKDGTAGIERPKALLDSLPEDPRPLMTLSSRHVVSSRQFDRETLVQ
IFRLAAQYESTPALLHPPLAGKILISAFYEPSTRTRLSFESAWHRLGGDIMSITDPKSTG
MAKGESLADIAEMFNNYGDVIVLRNNEGPAIYEMLDSLRIPIINAGNGIDEHPTQAMADV
YTIMKWRPELARTDLPAGQRIRIGIIGVPSRMRTVRSLLLTLGCFAHAIEEVVILSREDD
LFDEGQAQELAEAGLKVRVATDLDGELPSLDVVYINAIAWVGDTFEAMGMDMRLSAASPL
KKGAIVLHPLARGEELSTDLDKTPHNWYFAQARGAVFIRMALLTCMVRRISEVMDVPDVG
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaccaacgacgcgcagctggaccgcccgctgcagcccaaggacggtaccgcc
ggcattgagcggcccaaggcgctgctggacagcctgcccgaggacccgcgcccgctcatg
accctgtccagccggcacgtggtctcctcgcgccagttcgaccgggagaccctggttcag
atctttcgcctggcggcccagtacgagagcacgcccgcgctgctgcatccgcccctggcc
ggcaagatcctgatcagcgccttctacgagccgagcacccgcacgcgcctgtccttcgag
agcgcctggcaccggctgggcggggacatcatgtccatcactgatcccaagagcacgggc
atggccaagggcgaatccctcgccgacatcgccgagatgttcaacaactacggtgacgtg
atcgtgctgcgcaacaacgaaggcccggcgatctacgagatgctggactccctgcgcatc
cccatcatcaatgccggcaacggcatcgacgagcaccccacccaggccatggcggatgtc
tacaccatcatgaagtggcgtcccgaactggcccgcacggatctgcccgccgggcagcgc
atccgcatcggcatcatcggcgtgcccagccgcatgcgcaccgtgcgcagcctgctgctg
accctgggttgcttcgcccacgccatcgaggaggtggtgatcctgagtcgcgaggacgat
ctgttcgatgaggggcaggcccaggagctggccgaggccgggctcaaggtgcgcgtggct
acggatctggacggcgagctgccgagcctggacgtggtgtacatcaatgccatcgcctgg
gtgggagacaccttcgaggccatgggcatggacatgcgcctgtcagccgcatcgccgctg
aagaagggcgccatcgtgctgcacccgctcgcccgcggcgaggaactgtccaccgacctg
gataagaccccgcacaactggtacttcgcccaggcccgcggcgcggtgttcatccgcatg
gccctgctcacctgcatggtgcgccggatcagcgaggtcatggatgtgccggatgtcggg
cgcggctga

DBGET integrated database retrieval system