KEGG   Thioalkalivibrio sulfidophilus: Tgr7_0184Help
Entry
Tgr7_0184         CDS       T00840                                 

Definition
aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain-containing protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tgr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tgr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201454..202542
Genome map
AA seq 362 aa AA seqDB search
MVETNDAQLDRPLQPKDGTAGIERPKALLDSLPEDPRPLMTLSSRHVVSSRQFDRETLVQ
IFRLAAQYESTPALLHPPLAGKILISAFYEPSTRTRLSFESAWHRLGGDIMSITDPKSTG
MAKGESLADIAEMFNNYGDVIVLRNNEGPAIYEMLDSLRIPIINAGNGIDEHPTQAMADV
YTIMKWRPELARTDLPAGQRIRIGIIGVPSRMRTVRSLLLTLGCFAHAIEEVVILSREDD
LFDEGQAQELAEAGLKVRVATDLDGELPSLDVVYINAIAWVGDTFEAMGMDMRLSAASPL
KKGAIVLHPLARGEELSTDLDKTPHNWYFAQARGAVFIRMALLTCMVRRISEVMDVPDVG
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaccaacgacgcgcagctggaccgcccgctgcagcccaaggacggtaccgcc
ggcattgagcggcccaaggcgctgctggacagcctgcccgaggacccgcgcccgctcatg
accctgtccagccggcacgtggtctcctcgcgccagttcgaccgggagaccctggttcag
atctttcgcctggcggcccagtacgagagcacgcccgcgctgctgcatccgcccctggcc
ggcaagatcctgatcagcgccttctacgagccgagcacccgcacgcgcctgtccttcgag
agcgcctggcaccggctgggcggggacatcatgtccatcactgatcccaagagcacgggc
atggccaagggcgaatccctcgccgacatcgccgagatgttcaacaactacggtgacgtg
atcgtgctgcgcaacaacgaaggcccggcgatctacgagatgctggactccctgcgcatc
cccatcatcaatgccggcaacggcatcgacgagcaccccacccaggccatggcggatgtc
tacaccatcatgaagtggcgtcccgaactggcccgcacggatctgcccgccgggcagcgc
atccgcatcggcatcatcggcgtgcccagccgcatgcgcaccgtgcgcagcctgctgctg
accctgggttgcttcgcccacgccatcgaggaggtggtgatcctgagtcgcgaggacgat
ctgttcgatgaggggcaggcccaggagctggccgaggccgggctcaaggtgcgcgtggct
acggatctggacggcgagctgccgagcctggacgtggtgtacatcaatgccatcgcctgg
gtgggagacaccttcgaggccatgggcatggacatgcgcctgtcagccgcatcgccgctg
aagaagggcgccatcgtgctgcacccgctcgcccgcggcgaggaactgtccaccgacctg
gataagaccccgcacaactggtacttcgcccaggcccgcggcgcggtgttcatccgcatg
gccctgctcacctgcatggtgcgccggatcagcgaggtcatggatgtgccggatgtcggg
cgcggctga

DBGET integrated database retrieval system