KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0184Help
Entry
Tgr7_0184         CDS       T00840                                 

Definition
(GenBank) aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00240  Pyrimidine metabolism
tgr00250  Alanine, aspartate and glutamate metabolism
tgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tgr7_0184
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tgr7_0184
Enzymes [BR:tgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tgr7_0184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACL71283
JGI: Tgr7_0184
UniProt: B8GU00
Position
201454..202542
Genome map
AA seq 362 aa AA seqDB search
MVETNDAQLDRPLQPKDGTAGIERPKALLDSLPEDPRPLMTLSSRHVVSSRQFDRETLVQ
IFRLAAQYESTPALLHPPLAGKILISAFYEPSTRTRLSFESAWHRLGGDIMSITDPKSTG
MAKGESLADIAEMFNNYGDVIVLRNNEGPAIYEMLDSLRIPIINAGNGIDEHPTQAMADV
YTIMKWRPELARTDLPAGQRIRIGIIGVPSRMRTVRSLLLTLGCFAHAIEEVVILSREDD
LFDEGQAQELAEAGLKVRVATDLDGELPSLDVVYINAIAWVGDTFEAMGMDMRLSAASPL
KKGAIVLHPLARGEELSTDLDKTPHNWYFAQARGAVFIRMALLTCMVRRISEVMDVPDVG
RG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaccaacgacgcgcagctggaccgcccgctgcagcccaaggacggtaccgcc
ggcattgagcggcccaaggcgctgctggacagcctgcccgaggacccgcgcccgctcatg
accctgtccagccggcacgtggtctcctcgcgccagttcgaccgggagaccctggttcag
atctttcgcctggcggcccagtacgagagcacgcccgcgctgctgcatccgcccctggcc
ggcaagatcctgatcagcgccttctacgagccgagcacccgcacgcgcctgtccttcgag
agcgcctggcaccggctgggcggggacatcatgtccatcactgatcccaagagcacgggc
atggccaagggcgaatccctcgccgacatcgccgagatgttcaacaactacggtgacgtg
atcgtgctgcgcaacaacgaaggcccggcgatctacgagatgctggactccctgcgcatc
cccatcatcaatgccggcaacggcatcgacgagcaccccacccaggccatggcggatgtc
tacaccatcatgaagtggcgtcccgaactggcccgcacggatctgcccgccgggcagcgc
atccgcatcggcatcatcggcgtgcccagccgcatgcgcaccgtgcgcagcctgctgctg
accctgggttgcttcgcccacgccatcgaggaggtggtgatcctgagtcgcgaggacgat
ctgttcgatgaggggcaggcccaggagctggccgaggccgggctcaaggtgcgcgtggct
acggatctggacggcgagctgccgagcctggacgtggtgtacatcaatgccatcgcctgg
gtgggagacaccttcgaggccatgggcatggacatgcgcctgtcagccgcatcgccgctg
aagaagggcgccatcgtgctgcacccgctcgcccgcggcgaggaactgtccaccgacctg
gataagaccccgcacaactggtacttcgcccaggcccgcggcgcggtgttcatccgcatg
gccctgctcacctgcatggtgcgccggatcagcgaggtcatggatgtgccggatgtcggg
cgcggctga

DBGET integrated database retrieval system