KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0261Help
Entry
Tgr7_0261         CDS       T00840                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Brite
Enzymes [BR:tgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tgr7_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 RrnaAD Methyltransf_23 Methyltransf_32 GCD14 Methyltransf_12 CMAS Methyltransf_3 MetW
Motif
Other DBs
NCBI-ProteinID: ACL71360
JGI: Tgr7_0261
UniProt: B8GU77
Position
complement(287755..288432)
Genome map
AA seq 225 aa AA seqDB search
MHEQRRKYIQALIDTLKRDFRETAGSTGLDAPDPRILEAIRQVPRDRFVPERSLDMAWEN
TALSIGYGQTISQPYVVALMTQLLELTPESRVLEIGTGSGYQAALLGELAGEVYSIEVVP
ELAAQAKTRLEEMGYGNVHVRAGNGRLGWPEAAPFDAVIVTAAAEDIPEALVDQLRPGGR
MVIPVNTGWYGQDLVLGIKGEDGELKTRSILAVVFVPLVGKEDVP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaacaacgccgcaaatacatccaggccctgatcgacaccctcaagcgtgacttc
cgcgagaccgccggcagtaccggcctggacgccccggacccgcgcatcctggaggccatc
cgccaggtgccccgggaccgcttcgtgccggagcgcagcctggacatggcctgggagaac
acggcgctgtccatcggctacgggcagaccatctcccagccctacgtggtggcgttgatg
actcagctcctggagctcacgccagagagccgggtgctggagatcggcaccggctccggc
taccaggcggccctgctgggggagctcgccggggaggtctacagcatcgaggtggtgccg
gaactggcggcgcaggcaaagacccgcctcgaagagatgggctacggcaacgtccacgtg
cgcgccggcaatggccgcctgggctggcccgaggcggcgcccttcgacgctgtgatcgtc
accgccgccgccgaggacatccccgaggccctggtggatcagctgcgccccggtggacgc
atggtgatcccggtgaacaccggctggtacggccaggacctggtcctgggcatcaagggc
gaggacggcgaactcaagacccgcagcattctggccgtggtcttcgtgccgctggtgggg
aaagaggatgtcccgtag

DBGET integrated database retrieval system