KEGG   Thioalkalivibrio sulfidophilus: Tgr7_0282Help
Entry
Tgr7_0282         CDS       T00840                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_0282
   01230 Biosynthesis of amino acids
    Tgr7_0282
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_0282
   00030 Pentose phosphate pathway
    Tgr7_0282
   00051 Fructose and mannose metabolism
    Tgr7_0282
   00052 Galactose metabolism
    Tgr7_0282
  Energy metabolism
   00680 Methane metabolism
    Tgr7_0282
Enzymes [BR:tgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tgr7_0282
Protein phosphatases and associated proteins [BR:tgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tgr7_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
318281..319540
Genome map
AA seq 419 aa AA seqDB search
MPNNVLYAQSGGVTAVINASACGVIQTARALPETFGKVYAGKDGILGVLREELIDLDRES
EETIAGLRHTPGGAFGSCRFDLGDPDTHPEQYRRLVEVFRAHDIGYFFYNGGGGSMDTAL
KVARIADEMGYPIVSVGVPKTIDNDLACTDTSPGFGSAAKFIATVVREASMDVESMASSS
TKVFIMEVMGRHAGWLAAAAALAQQSKDSPPMLILFAEIPFDQADFLRRLNDVIATHGYC
VVVASEGLKGPDGKLLTVAQSHDVYAYTQLGGVAPMLAGMIKEKTGHKIHWAVADYIQRS
ARHIAARVDVEQAYATGAMAVRFAAEGHTGFMPVIRRLCDAPYLWTVDRVPLEQVANIEQ
GMPRDFISEGGYGITEACRRYLRPLIEGEAYPPYEGGLPRYVRIRGELLEKKLPAFELK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaacgtcctctatgcccagtccggcggggtgaccgccgtcatcaatgccagt
gcctgcggggtgatccagaccgcccgggccctcccggagaccttcggcaaggtctatgcg
ggcaaggacggcatcctcggcgtgctgcgcgaggaactgatcgacctggaccgggagtcc
gaggagaccatcgccggcctgcgccacacccccggcggcgccttcggttcctgccgattc
gacctgggcgacccggacacgcacccggaacagtaccggcgcctggtggaggtcttccgc
gcccacgacatcggctacttcttctacaacggcggcggcggctccatggacacggcgctc
aaggtggcgcgcatcgccgacgagatgggctatcccatcgtcagcgtgggcgtgcccaag
accatcgacaacgacctggcctgcaccgacaccagccccggcttcggctccgccgccaag
ttcatcgccaccgtggtgcgcgaggccagcatggacgtggagtccatggccagttccagc
accaaggtgttcatcatggaggtgatgggccgccatgcgggctggctggccgccgccgcg
gccctggcccagcagtccaaggacagcccgcccatgctgatcctgttcgccgagatcccc
ttcgaccaggcggacttcctgcgccggctcaacgacgtgatcgccacccacggctattgc
gtggtggtggcctcggaagggctcaagggacccgacggcaagctgctcaccgtggcccag
tcccacgatgtctacgcctatacccagctgggcggcgtggcccccatgctggcgggcatg
atcaaggagaagaccggccacaagatccactgggcggtggccgattacatccagcgatcg
gcccggcacatcgccgcccgggtggacgtggagcaggcctacgccaccggtgccatggcg
gtgcgcttcgccgccgagggccacaccggcttcatgccggtgatcaggcgcctgtgcgac
gccccctacctgtggaccgtggaccgggtgcccctggaacaggtggccaacatcgagcag
ggcatgccgagggatttcatcagcgagggcggctacggcatcaccgaggcctgccggcgc
tacctgcgcccgctcatcgagggcgaggcctacccgccctacgagggcggcctgccccgc
tacgtgcgcatccgcggcgaattgctggagaagaagctgccggcgtttgaactcaaataa

DBGET integrated database retrieval system