KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0355Help
Entry
Tgr7_0355         CDS       T00840                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_0355
   01230 Biosynthesis of amino acids
    Tgr7_0355
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_0355
   00030 Pentose phosphate pathway
    Tgr7_0355
   00051 Fructose and mannose metabolism
    Tgr7_0355
   00052 Galactose metabolism
    Tgr7_0355
  Energy metabolism
   00680 Methane metabolism
    Tgr7_0355
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tgr7_0355
Enzymes [BR:tgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tgr7_0355
Protein phosphatases and associated proteins [BR:tgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tgr7_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(397403..398614)
Genome map
AA seq 403 aa AA seqDB search
MANKVLVAQGGGPTAVINQSMVGAVLESRKFRNVELVYGAFHGVRGIVDEEFLDLTQETS
HNLELVAQTPSSALGSTRDKPDLKYCQEIFKVLKAHEIGYFFYIGGNDSSDTVRIVSEEA
QKANYDLRCIHIPKTIDNDLVENDHTPGFPSAARFVAQSFMGANLDNWALPGVYIGVVMG
RHAGFLTAAAALGKKFPDDGPHLIYLPERVFDIDRFLADVKATMERYGRCVVAVSEGIHD
AEGTPIVVKLAKEVEKDAHGNVQLSGTGQLADMLCDEIKNKLGIKRVRGDTFGYLQRSFV
GCVSDVDQREAREVGEKAVQYAMWGKQDGSVVIERTGFYSVDYRLAPLEAVAGKTKVMPD
EFITASGTDVTDAFRLYLRPLLGSGMPDAYRLRQNLVEKVLKK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaaggtactcgtcgcccaggggggcggccccacggccgtaatcaatcagtcc
atggtgggcgccgtactggagtcccgcaaattcaggaacgttgagctggtgtacggcgca
ttccacggcgtgcgcggcatcgtggacgaggagttcctggacctgacccaggagaccagc
cacaacctggaactggtggcccagaccccgtcttccgcgctcggctccacccgtgacaag
cccgacctcaagtactgccaggagatcttcaaggtcctcaaggcccatgagatcggctac
ttcttctacatcggcggcaacgactcctcggacaccgtgcgcatcgtcagcgaggaggcc
cagaaggccaattacgacctgcgctgcatccacatccccaagaccatcgacaacgacctg
gtggaaaacgaccacacgcccggcttcccgtccgccgcgcgcttcgtggcccagtccttc
atgggcgcaaacctggacaactgggcccttcccggtgtgtacatcggcgtggtcatgggt
cgtcatgcgggctttctcaccgccgccgccgcgctcggcaagaagttcccggacgacggt
ccgcacctgatctacctgccggagcgggtgttcgacatcgacaggttcctggcggacgtg
aaggccaccatggagcgctacgggcgctgcgtggtcgccgtgagcgagggcatccacgac
gccgagggcacccccatcgtggtgaagctggccaaggaagtggaaaaggatgcccacggc
aacgtgcagctctccggcaccggccagctggcggacatgctctgcgacgagatcaagaac
aaactcggcatcaagcgcgtgcgcggcgacaccttcggctacctgcagcgctccttcgtg
ggctgcgtctccgacgtggaccagcgcgaggcccgggaggtgggcgagaaggcggtgcag
tacgccatgtggggcaagcaggatggctccgtggtgatcgagcgcaccggcttctactcg
gtggactaccggctcgcgcccctcgaggcggtggccggcaagaccaaggtcatgcccgat
gagttcatcaccgcctccggcacggacgtcaccgacgccttccgtctgtacctgcgcccg
ctgctgggttccggcatgccggacgcctaccgcctgcgccagaacctggtggagaaggtg
ctcaagaagtag

DBGET integrated database retrieval system