KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0742Help
Entry
Tgr7_0742         CDS       T00840                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00520  Amino sugar and nucleotide sugar metabolism
tgr00550  Peptidoglycan biosynthesis
tgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tgr7_0742
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tgr7_0742
Enzymes [BR:tgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Tgr7_0742
Peptidoglycan biosynthesis and degradation proteins [BR:tgr01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Tgr7_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ACL71834
JGI: Tgr7_0742
UniProt: B8GMK2
Position
796182..797441
Genome map
AA seq 419 aa AA seqDB search
MDKLIIRGGRPLNGDVRISGAKNAVLPILASTLLADSPMTIGNVPHLQDVTTTMELLGRM
GASLTVDERMHIEVDPTTTHDFVAPYELVKTMRASILVLGPMLARFGQAEVSMPGGCAIG
SRPVNLHVDGLAAMGADISIDSGYIRARADRLKGARIVMDIVSVTGTENLMMAAALARGT
TVIENAAREPEVVDLANCINTMGGQISGAGTDTIVIDGVETLHGCHYDVLPDRIETGTFL
VAGAITGGKVRLRNTAPATLDAVLAKLEEAGAQMNIGEDWIELDMVGRRPRSVGLRTAPY
PAFPTDMQAQFMALNSVAEGTAAIVETVFENRFMHALELQRMGADIRVEGNTALVRGVPK
LTGAPVMATDLRASASLILAGLVAEGETLVDRIYHIDRGYECIEEKLSQLGASIRRVPG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggacaagttgatcattcgtggcgggcgtcccctgaacggcgacgtgcgtatctccggc
gccaagaacgccgtgctgcccatcctggcatccaccctgctcgcggacagcccgatgacc
atcggcaacgtgccgcatctgcaggacgtgaccaccaccatggagttgctggggcgcatg
ggtgcttcgctcaccgtggacgagcgcatgcatatcgaggtggaccccaccaccacccat
gacttcgtcgccccctatgagctggtgaagaccatgcgcgcctccatcctggtgctgggg
cccatgctggcccgtttcggccaggcggaggtctccatgcccggtggctgcgccattggt
tcccggccggtgaatctgcacgtggacggactggccgccatgggcgccgacatcagtatc
gacagcggctacattcgtgcccgcgctgaccggctcaagggggcgcgcatcgtcatggac
atcgtgtcggtcaccggcacggagaacctgatgatggccgcggccctggcccggggcacc
acggtgatcgagaacgccgcccgggagcccgaggtggtggatctggccaactgtatcaac
accatgggcgggcagatctccggtgccggcacggataccatcgtcatcgacggcgtggag
accctgcacggctgccactacgacgtgctgccggatcgcatcgagaccggcaccttcctg
gtggccggggccatcaccggcggcaaggtgcggcttcgcaataccgcgccggcgacactg
gatgcggtgctggccaagctggaggaggccggtgcgcagatgaacatcggtgaggactgg
atcgagctggatatggtcggacgccggccccggtccgtgggactgcgtaccgcgccttat
ccggccttccccacggatatgcaggcccagttcatggccctgaactccgtggccgaaggc
acggcggccattgtcgagacggtgttcgaaaatcgcttcatgcatgccctggaactgcag
cgtatgggtgccgatatccgggtcgaaggcaacaccgccctggtgcgcggcgtgcccaaa
ctcaccggcgccccggtgatggccaccgacctgcgcgcctcggcgagcctgatcctggct
ggtctggtggccgaaggcgagaccctggtggaccgcatttatcacatcgatcgtggctat
gagtgcatcgaggaaaaactttcccagctgggcgccagcatccgacgcgtgcccggttaa

DBGET integrated database retrieval system