KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0808Help
Entry
Tgr7_0808         CDS       T00840                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_0808
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tgr7_0808
   00640 Propanoate metabolism
    Tgr7_0808
   00660 C5-Branched dibasic acid metabolism
    Tgr7_0808
Enzymes [BR:tgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tgr7_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
874082..875242
Genome map
AA seq 386 aa AA seqDB search
MNLHEFQAKALFREHGIPVPEGVAVSDPAALGEAISSLGGDAWVVKAQVHAGGRGKAGGV
RLVKGSRELEHAVGELLGGRLATHQTGPAGLPINTVLVESLTDIGRELYLSLLVDRARRR
VAIMASAAGGMDIETVAAESPEKIITLHVDPAAGYMPYQGRRVAFALGLEGPQVSALVKL
LGQLYRLFVDSDASLVEINPLVVTKTGELIALDAKINLDDNGLYRHQALAELRDETQEDA
REARAREHELNYVRLDGNIGCMVNGAGLAMATMDLIKLHGGEPANFLDVGGGTTAARVAE
AFKLILSDEAVKAVFVNIFGGIVRCDLIAEGIINAVKEVHVTVPVVVRLEGTNVDQGKQM
LAESGLNIITAESLTDGARRVVASVQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcacgaatttcaggccaaggcactgttccgcgaacacggcatccccgtgccc
gagggcgtggccgtgagcgatcccgccgcgctgggcgaggcgatcagttcactcggcggt
gatgcctgggtggtcaaggcccaggtccacgccggtggccgcggcaaggcgggcggcgtg
cgcctggtcaagggctccagggaactggaacatgccgtgggcgaactgctgggcggccgg
ctcgccacccaccagaccggtcccgcaggcctgcccatcaacaccgtgctggtggagtcc
ctcaccgatatcggccgggagctgtatctgagtctcctggtggaccgtgcccggcgccgg
gtggccatcatggcctccgcggccggcggcatggacatcgagaccgtggccgccgagagc
cccgagaagatcatcacgctgcacgtggatccggccgccggctacatgccctaccagggc
cgccgcgtggccttcgccctggggctggaagggccgcaggtctccgccctggtgaagctg
ctgggccagctctaccggctgttcgtggacagcgatgcgagcctggtggagatcaacccc
ctggtggtcaccaagaccggggagctcattgccctggacgccaagatcaacctggacgac
aacggcctgtaccgccaccaggcgctggccgaactgcgcgacgagacccaggaggacgcc
cgtgaggcccgtgcccgggagcacgaactcaactacgtgcgcctggacggcaacatcggc
tgcatggtcaacggcgcaggcctggccatggccaccatggatctcatcaagctgcacggc
ggcgagcccgccaacttcctggacgtgggcggcggcaccaccgcggcccgggtggccgag
gccttcaagctgatcctctccgacgaggccgtgaaggcggtgttcgtgaacatcttcggc
ggcatcgtgcgctgcgacctgatcgcggaaggcatcatcaacgccgtcaaggaagtccat
gtgaccgtgcccgtggtggtgcgcctggaaggcaccaacgtggaccagggcaagcagatg
ctggccgagagcggcctgaacatcatcaccgccgagtccctcaccgacggtgccaggcgg
gtggtggcgtcggtccagtga

DBGET integrated database retrieval system