KEGG   Thioalkalivibrio sulfidophilus: Tgr7_0881Help
Entry
Tgr7_0881         CDS       T00840                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tgr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(949700..950203)
Genome map
AA seq 167 aa AA seqDB search
MSGVLAYIGLGSNLQDPVDQVARALTALADLPETRCVARSALYASPPMGPQDQPDYINAV
ACLSTALAPRDLLASLQAIERAHGRVRNGTRWGPRTLDLDILLYGGRQIHEPGLSVPHPG
IPERPFVVHPLAEIAPRDLVLPGHGPLALLLSRCPQGDLRRLEPVPA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgtactggcctacatcggtcttggcagcaacctccaggaccccgtcgatcag
gtcgcccgggcgctcacggccctggccgacctgcccgagacccgctgcgtggcgcgctcc
gccctgtacgccagtccgcccatgggtccccaggaccagcccgactacatcaacgccgtc
gcctgcctgtccacggcgcttgcgccccgggacctgctggccagcctgcaggccatcgaa
cgggcccacggccgggtgcgtaacggcacccgctggggaccgcgcaccctggacctggac
atcctgctctacggggggcgccagatccacgagccgggcctgagcgtgccccaccccggc
atcccggaacgccccttcgtggtccatccgctggcggagatcgcgcccagggacctggta
ctgcccggtcacggccccctggccctgctgctcagccgctgcccgcagggcgacctgcgt
cgcctggagcccgtgcccgcgtga

DBGET integrated database retrieval system