KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_0984Help
Entry
Tgr7_0984         CDS       T00840                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tgr7_0984
   01230 Biosynthesis of amino acids
    Tgr7_0984
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_0984
   00051 Fructose and mannose metabolism
    Tgr7_0984
   00562 Inositol phosphate metabolism
    Tgr7_0984
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tgr7_0984
Enzymes [BR:tgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tgr7_0984
Exosome [BR:tgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tgr7_0984
  Exosomal proteins of bladder cancer cells
   Tgr7_0984
  Exosomal proteins of melanoma cells
   Tgr7_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1064949..1065710
Genome map
AA seq 253 aa AA seqDB search
MRQPLVAGNWKMNGSLKANEALLGDLRKALSGGIKAEVAVCPPFVYLPQVAGLIDGQPMA
LGAQDLSDQDAGAFTGEVSGTMLKDLGCEYVIVGHSERRSLYGEGDEFTARKFAAARRHG
LKPILCVGELLEERESGVTEQVVARQLDAVMDLEGVSALADAVIAYEPVWAIGTGKTASP
EQAQAVHAFIRARVAERDAQVAEGLRILYGGSVKADNAAELFSQPDIDGGLIGGASLKAD
DFMAICRAAEQAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagccactggtggcaggcaactggaaaatgaacggttccctgaaggccaatgag
gcgttgctgggcgaccttcgcaaggccctctcaggtggtatcaaggcagaggtcgccgtg
tgtccccccttcgtgtatctcccccaggtggcgggtctgatcgatggccagcctatggcc
ctgggtgcccaggatctctccgaccaggatgccggcgccttcaccggcgaggtatccggg
accatgctcaaggacctgggttgtgaatacgtcatcgtgggtcattcggagcgtcgcagc
ctgtacggcgagggcgacgagttcacggcccgcaagtttgccgccgcccggcgccacggc
ctcaagcccatcctgtgcgtgggcgaactgctcgaggagcgcgagtccggcgtgaccgag
caggtggtggcgcggcagctggatgcggtgatggatctggagggcgtgtccgccctggcc
gacgcggtgatcgcctatgagcccgtgtgggccatcggtaccggcaagaccgccagcccc
gagcaggcccaggcggtgcatgccttcatccgcgctcgcgtggccgaacgggatgcgcaa
gtggccgagggtctgcgcatcctctacggcggcagcgtgaaagccgacaatgctgcggaa
ctgttttcgcagccggatattgacggaggcctgatcggcggcgcctccctgaaggctgat
gatttcatggccatttgccgcgcggccgaacaggcgagttga

DBGET integrated database retrieval system