KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1019Help
Entry
Tgr7_1019         CDS       T00840                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00010  Glycolysis / Gluconeogenesis
tgr00620  Pyruvate metabolism
tgr00640  Propanoate metabolism
tgr00680  Methane metabolism
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01120  Microbial metabolism in diverse environments
tgr01130  Biosynthesis of antibiotics
tgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tgr7_1019
   00620 Pyruvate metabolism
    Tgr7_1019
   00640 Propanoate metabolism
    Tgr7_1019
  Energy metabolism
   00680 Methane metabolism
    Tgr7_1019
Enzymes [BR:tgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tgr7_1019
Lipid biosynthesis proteins [BR:tgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tgr7_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACL72106
JGI: Tgr7_1019
UniProt: B8GP17
Position
complement(1105413..1107356)
Genome map
AA seq 647 aa AA seqDB search
MSEVKVHEIPEAFAAQAHVNAQQYQEMYQRSVDDPEGFWSEQADKYVTWFKKWDKVLDWS
FAGDVHIRWFEGAKLNVSYNCLDRHLETRGDQPAIIWEGDDPNEDRTLTYRELHAEVSRF
ANVLKSRGVKKGDRVSIYMPMIPEAAVAMLACTRIGAIHSVVFGGFSPDALRDRIQDSDC
QVVITSDQSLRGGKKVPLKANADKAIAQCPNVHTCIVVKRGGEQVNWHDDRDVWYHEAMK
EASAECPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLLQAAMTHKLVFDYKDGETYW
CTADVGWVTGHTYIVYGPLANGARSLMFEGIPTYPDTGRFWQVCDKHKVSTFYTAPTAIR
MLMGAGDDFVKKHKRSSLRLLGTVGEPINPEAWEWYYRVVGDERCPIVDTWWQTETGGHM
ITPLPGATRLKAGSATHPFFGVQPVLLDDQGKEITGNPATGNLCIKHPWPGMMRTVYGDH
PRFIETYFKLYPGYYFSGDGARRDEEGYYWITGRVDDVLNVSGHRLGTAEIESALVLHPK
VAEAAVVGYPHEITGQGIYAYVTLMAGEQGSEELKKELVNLVREEIGPIAKVNLLQFAPG
LPKTRSGKIMRRILRKIAANELDNLGDTSTLADPGVVDNLIDNRLNK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtcaaagtccacgagatccccgaggcgttcgccgcccaggcccacgtcaac
gcccagcagtaccaggagatgtaccagcgctccgtggacgacccggagggcttctggtca
gagcaggccgacaaatacgtcacctggttcaagaagtgggacaaggtgctggactggtcc
ttcgccggcgacgtgcacatccgctggttcgagggcgccaagctcaacgtctcctacaac
tgcctggatcgccacctggagacccgcggcgaccagcccgccatcatctgggagggggat
gatcccaacgaggaccgcaccctcacctaccgggagctgcacgccgaggtcagccgcttc
gccaatgtgctcaagtcacgcggcgtgaagaagggcgaccgggtctccatctacatgccc
atgatccccgaggcggccgtggccatgctggcctgcacccgcatcggtgccatccattcc
gtggtgttcggcggtttctcccccgacgccctgcgcgaccgcatccaggactccgactgc
caggtggtgatcacctccgaccagagcctgcgcggcggcaagaaggtgccgctcaaggcc
aacgccgacaaggccatcgcccagtgtcccaacgtgcacacctgcattgtggtcaagcgc
ggcggcgagcaggtgaactggcatgatgatcgtgacgtctggtaccacgaggccatgaag
gaggcctccgccgagtgtccgccggaggagatgaacgccgaggacccgctgttcatcctc
tacacctccggctccaccggcaaacccaagggcgtgctgcacaccaccggcggctacctg
ctgcaggcggccatgacccacaagctggtcttcgactacaaggacggtgagacctactgg
tgcaccgccgacgtgggctgggtcaccggccacacctacatcgtctacggcccgctggcc
aacggcgcgcgctcgctgatgttcgagggcatccccacctaccccgacaccggacgcttc
tggcaggtgtgcgacaagcacaaggtgtccaccttctacaccgcgcccacagccatccgc
atgctcatgggcgcgggagacgacttcgtcaagaagcacaagcgttcgtccctgcgcctg
ctgggcaccgtgggcgagcccatcaaccccgaggcctgggagtggtattaccgggtggtg
ggcgacgagcgctgcccgatcgtggacacctggtggcagaccgagaccggcggccacatg
atcacccccctgcccggtgccaccaggctcaaggccggatccgccacccatcccttcttc
ggcgtgcagccggtgctgctggatgatcagggcaaggagatcaccggcaatcccgccacc
ggcaacctgtgcatcaagcatccctggccggggatgatgcgcacggtctacggcgatcat
ccccgcttcatcgagacctacttcaagctctatcccggctattacttctccggtgacggc
gcgcgccgggacgaggaaggctattactggatcaccggccgcgtggacgacgtgctcaac
gtctccggccaccgcctcggcaccgccgagatcgaatccgccctggtgctgcatcccaag
gtggccgaggccgccgtggtgggctatccccacgagatcaccggccagggcatctacgcc
tacgtcacgctgatggccggcgaacagggcagcgaggagctgaagaaggaactggtcaac
ctggtgcgcgaggagatcggccccatcgccaaggtcaacctgctgcagttcgccccgggc
ctgcccaagacccgttccggcaagatcatgcgccgcatcctgcgcaagatcgccgccaac
gaactggacaacctgggtgatacctcgaccctggccgatcccggcgtggtggacaacctg
atcgacaatcgcctcaataagtag

DBGET integrated database retrieval system