KEGG   Thioalkalivibrio sulfidophilus: Tgr7_1228Help
Entry
Tgr7_1228         CDS       T00840                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tgr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1317536..1318210)
Genome map
AA seq 224 aa AA seqDB search
MSESLAASDETRARDALTRAGLALYRAGLNQEAEGNLSLRLGEGLLITPSGLPWERLTPQ
RLVLLDRDNHARGGRPSSEWPLHRAILDARPEVHAVVHTHSMFATTLACLRRDLPPFHYM
IAQAGGPDIRCSRYATFGSQDLAEAAVDALQDRKACLLASHGMVTVGKTLEEAVSLALTV
EKLCEQYWRACQLGEPVLLSDAEMDEVMAQFSDYGPQYDEKDLT
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaatccctggcagccagcgacgagacccgggcccgggacgcactcacccgggcc
ggactcgccctgtaccgggcgggactcaaccaggaagcggaaggcaatctcagcctgcgc
ctgggcgagggtctgctcatcaccccgtccggccttccctgggaacggctcacgccgcag
cgcctggtcctactggatcgcgacaaccacgcccggggcgggcgcccttccagcgaatgg
cccctgcaccgggcgatcctcgatgcgcgccccgaggtccatgccgtggtgcacacccat
tccatgtttgccaccaccctcgcctgcctgcgccgggacctgccgcccttccactacatg
atcgcccaggccggcggcccggacatccgctgcagccgctacgccaccttcggcagccaa
gacctggccgaggccgccgtagatgcactgcaggaccgcaaggcgtgcctgctggccagc
cacggcatggtcacggtggggaaaaccctggaggaggcggtgagcctcgcactcaccgta
gagaagctctgcgaacagtactggcgcgcctgccagctgggggaaccggtgctgctgagc
gatgcggagatggacgaggtgatggcgcaattctccgactacggcccacagtacgatgaa
aaagacctaacgtag

DBGET integrated database retrieval system