KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1253Help
Entry
Tgr7_1253         CDS       T00840                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tgr7_1253
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tgr7_1253
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tgr7_1253
Enzymes [BR:tgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tgr7_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1346797..1348026
Genome map
AA seq 409 aa AA seqDB search
MTATAEKNTALDWSAYPDAHGHFGPYGGQFVSETLMEPLEELREAYDRYVKDPEFLAELD
ADLADYVGRPSPLYHAERMSRELGGAQIYLKREDLNHTGAHKVNNTIGQALLAKRMGKTR
IIAETGAGQHGVASATVAARLGLECVVYMGAEDIQRQAPNVYRMRLLGATVVPVTSGSRT
LKDALNEAMRDWVTNVDNTFYIIGTVAGPHPYPAMVRDFQSVIGREAREQCLKRTGRLPD
ALVACVGGGSNAIGLFHPFLGDESVALYGVEAAGDGIETGRHSAPLCAGKPGVLHGNRTY
LMEDADGQIIETHSISAGLDYPGVGPEHAWLKDTGRARYVSVTDDEAMAAFHHLTRTEGI
IPALESSHAIAYVMKLAPTLDKDKIIIVNLSGRGDKDINTVARLEGIEL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgactgcaacggctgaaaagaacaccgcgctcgactggagtgcctacccggacgcccac
ggccacttcggcccctacggcgggcagttcgtctccgagaccctgatggagcccctggag
gaactgcgcgaggcctatgaccgttacgtgaaggatcccgagttcctggcggaactggac
gcggacctggccgactacgtggggcgcccgagccctctgtaccacgccgagcgcatgagc
cgggagctgggtggcgcgcagatctacctcaagcgcgaggatctgaaccacaccggcgcc
cacaaggtgaacaacaccatcggccaggccctgctggccaagcgcatgggcaagacccgc
atcatcgccgagaccggtgccggccagcacggcgtggccagcgccacggtggcggcgcgc
ctgggcctggagtgcgtggtgtacatgggcgccgaggacatccagcgccaggcccccaac
gtctaccgcatgcgcctgctgggcgccacggtggtgccggtgacctccggctcgcgcacg
ctcaaggacgccttgaacgaggcgatgcgcgactgggtcaccaacgtggacaacaccttc
tacatcatcggtaccgtggccggcccccatccctatccggccatggtgcgggacttccag
tcggtgatcggccgcgaggcccgggaacagtgcctcaagcgcaccgggcgcctgcccgat
gccctggtggcctgcgtgggcggcggttccaatgccatcggtctgttccaccccttcctg
ggtgacgagagcgtggcgctctacggcgtggaggcggcgggtgacggcatcgagacgggc
cggcactccgcgcccctgtgcgccggcaagcccggcgtgctgcacggcaaccgcacctac
ctgatggaagacgccgacggccagatcatcgagacccattccatctccgcgggtctcgac
tatcccggcgtcggccccgagcatgcctggctcaaggacaccgggcgtgcccgctacgtc
tcggtcaccgacgacgaggccatggccgcgttccatcacctgacacgcaccgagggtatc
atcccggcgctggagtccagccacgccattgcctacgtgatgaagctcgcaccgaccctc
gacaaggacaagatcatcatcgtcaatctctccggtcgcggtgacaaggacatcaacacc
gtggcgcgcctggagggaatcgaactgtga

DBGET integrated database retrieval system