KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1254Help
Entry
Tgr7_1254         CDS       T00840                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00260  Glycine, serine and threonine metabolism
tgr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01130  Biosynthesis of antibiotics
tgr01230  Biosynthesis of amino acids
Module
tgr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tgr7_1254
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tgr7_1254
Enzymes [BR:tgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tgr7_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Peripla_BP_6 Pterin_bind CoA_binding_3 KDGP_aldolase
Motif
Other DBs
NCBI-ProteinID: ACL72340
JGI: Tgr7_1254
UniProt: B8GQE5
Position
1348023..1348823
Genome map
AA seq 266 aa AA seqDB search
MSRIARRFEALRAAGRKALIPYVTAGDPNPDNTVPLMHAMVAAGADIIELGVPFSDPMAD
GPVIQQACERALRHHVSLRQVIGMVKTFREQDAETPVVLMGYLNPVEIMGYEAFAIAAAS
AGVDGLLTVDLPPEESHDLVQVLRSHGVDPIFLLAPTSHEARIKRICDAASGFVYYVSLK
GVTGAATLDVDAVAEKLAAIRAHTDLPLGVGFGIRDADSAARVSRVADAVVVGSALVNRI
AEHEQDPEAGRRVVSELLAEMRKAMD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcatcgcccgacgtttcgaggccctgcgggccgccggccgcaaggccctgatc
ccctacgtcaccgccggtgatcccaacccggacaacaccgtaccgctgatgcacgccatg
gtggcggccggtgctgacatcatcgagctgggcgtgccgttctccgatcccatggccgac
ggcccggtgatccagcaggcctgcgagcgggccctgcgccatcacgtgagcctgcgccag
gtgatcggcatggtgaagaccttccgggagcaggacgccgagacaccggtggtgctcatg
ggttacctcaatccggtggagatcatgggctatgaggccttcgccatcgccgccgccagc
gccggcgtggacggactactcaccgtggacctgccccccgaggagagccacgacctggtg
caggtgctgcgcagccatggcgttgaccccatcttcctgctggcccccaccagccacgag
gcgcgcatcaagcgcatctgcgacgccgcctcgggctttgtgtactatgtgtccctgaaa
ggcgtgaccggggccgccaccctggacgtggacgcggtggccgagaagcttgccgccatc
cgggcgcatacggacctgccgctgggcgtgggtttcggtatccgcgatgcggactccgcc
gcccgggtctcccgggtcgccgacgccgtggtggtgggcagcgccctggtcaatcgcatt
gccgagcacgagcaggaccccgaggccgggcgccgcgtggtgagtgagctgctcgccgag
atgcgcaaggccatggattga

DBGET integrated database retrieval system