KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1342Help
Entry
Tgr7_1342         CDS       T00840                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tgr7_1342
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Tgr7_1342
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Tgr7_1342
Two-component system [BR:tgr02022]
 CheA family
  CheA-CheYBV
   Tgr7_1342
Bacterial motility proteins [BR:tgr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Tgr7_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1442152..1443237
Genome map
AA seq 361 aa AA seqDB search
MAVRALVVDDSGFFRRRIVEILDADPGIEVVGTAANGQEAIDEAARLRPDVIVMDIEMPV
MDGITAVRRIMARQPTPILMFSSLTFEGAKATLDALDAGAADFLPKRFEDISRDQQEARQ
VLCRRVRTLGMRRVRPAPAVPGTAAPAAARAATTAPAAGAPPARVDRSPVRMRDFRAVLI
GTSTGGPVALQKVLTALPANFPLPLLLVQHMPASFTPAFAQRLDSLCAIRVKEAADGDVL
QPGLALLAPGGLQMVVESRGGQQRVRIVESEAGQHYRPCVDVTFKSAAPVFGGQVLAIIM
TGMGADGREGVRALKQLGARVWAQDEESCVVYGMPAAVAEAGLADRILPLSQIGPLMANG
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcggtacgcgcactggtggtggacgattcgggtttcttccgacgtcgtatcgtcgag
atcctcgatgccgatccgggcatcgaggtggtgggtaccgccgccaatggccaggaggcc
atcgacgaggccgccaggctgcgtcccgacgtgatcgtcatggacatcgagatgccggtg
atggacggtatcaccgccgtgcgtcgcatcatggcgcgccagccgaccccgatcctgatg
ttctcctcgctcaccttcgagggggccaaggccaccctggatgccctggacgccggtgcc
gcggacttcctgcccaagcgtttcgaggacatctcccgggatcagcaggaggcacgccag
gtgctttgtcggcgggtccgcaccctcggcatgcgccgggtccgtcccgccccggcagtg
cccggcacggcggccccggccgcggcaagagccgccaccacggccccagccgcgggtgcc
ccgcctgcgcgcgtcgatcgcagcccggtacgcatgcgggatttccgcgcggtgctgatc
ggcacctccaccggcggaccggtggcgctgcagaaggtactcaccgcactgccggccaat
ttccccttgcccctgctgctggtgcagcacatgccggccagcttcacgccggcctttgcc
cagcgcctggattccctgtgcgccatccgcgtcaaggaggccgccgacggtgatgtgttg
cagccggggcttgccctgctcgcacccggcggtctgcagatggtggtggagtcccggggc
gggcagcagcgtgtacgcatcgtcgagagcgaagccggccagcactaccgtccctgcgtg
gacgtgaccttcaagtccgccgcgccggtgttcggcggccaggtgctggcgatcatcatg
accggcatgggcgccgacggccgcgagggcgtgcgtgcgctcaagcaactgggcgccagg
gtctgggcccaggacgaggagagctgcgtagtctacggcatgcccgccgcggtggccgag
gccggcctggcggaccgtatcctgcccctgtcccagatcgggcccctgatggccaacggt
gtttga

DBGET integrated database retrieval system