KEGG   Thioalkalivibrio sulfidophilus: Tgr7_1393Help
Entry
Tgr7_1393         CDS       T00840                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tgr7_1393
Enzymes [BR:tgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tgr7_1393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1490744..1491346
Genome map
AA seq 200 aa AA seqDB search
MSHHDCCEQEDDFPGADAEQRMAEDYTRIIRGLGEDPDRNGLIGTPLRAARAMSYLTRGY
HQSLDELVNGALFETDNDEMVLVRDIEFYSLCEHHLLPFLGRCHVAYLPKGRVIGLSKIA
RIVDMFARRLQIQETLTRQIAEAIESVTDARGVAVVMEAKHMCMMMRGVEKQNSTMTTSM
MTGTFRNDARTRAEFMGLIR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagccatcacgactgctgcgagcaggaagacgattttcccggtgccgatgccgaacag
cgcatggccgaggactacacccgcatcatccgcggcctcggggaggaccccgatcgcaac
ggcctgatcggcaccccgctgcgcgcggcccgggccatgtcctacctgacccgcggttat
caccagagcctggacgagctggtcaacggcgccctgttcgagaccgacaacgacgagatg
gtgctggtgcgcgacatcgagttctactccctgtgcgagcatcacctgctgcccttcctg
ggccgctgccacgtggcctacctgcccaagggcagggtgatcggtctgtccaagatcgcc
cgcatcgtggacatgttcgcccgccgcctgcagatccaggagaccctcacgcgccagatc
gccgaggccatcgagtcggtgaccgatgcccggggcgtggcggtggtcatggaggccaag
cacatgtgcatgatgatgcgcggcgtggagaagcagaactccaccatgaccacctccatg
atgaccggcaccttccgtaacgatgcccgcacccgtgcggaattcatgggcttgatcaga
tag

DBGET integrated database retrieval system