KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1433Help
Entry
Tgr7_1433         CDS       T00840                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Brite
Enzymes [BR:tgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tgr7_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD DREV
Motif
Other DBs
NCBI-ProteinID: ACL72518
JGI: Tgr7_1433
UniProt: B8GRG4
Position
1530096..1530761
Genome map
AA seq 221 aa AA seqDB search
MNTTISGIGMTSQRTRDRLVRQLEEAGIRNRRVLDVIRHTPRHLFVDEAMASRAYENTAL
PIGYGQTISQPYVVARMTEALLEGGPRRKVLEVGTGSGYQAAVLAPLVERVYSVERIQGL
QRRAREVLSTLRIRNVSLKHSDGGWGWPEQAPFDAIMLTAAPREIPEALLQQLGEGGVLV
APVGDEGGSQKLIRITRTANGFEQEVLESVSFVPMLPGTIT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccaccatcagtggcatcggcatgacctcccagcgtacccgggaccggctggtg
cgccagctggaggaggcgggtatccgcaaccgccgggtgctggacgtgatccgccatacc
ccccgccacctgttcgtggacgaggccatggccagccgggcctacgagaacaccgccctg
cccatcggttacggccagaccatctcccagccctacgtggtggcgcgcatgaccgaggcc
ctgctggagggcggtccgcgccgcaaggtgctggaggtgggcaccggctccggctaccag
gcggcagtgcttgcgccgctggtagagcgggtctacagcgtggaacgcatccagggcctg
cagcgccgcgcccgggaggtgctcagcaccctgcgcatccgcaacgtgagcctcaagcac
agcgacggcggctggggctggcccgagcaggcccccttcgacgccatcatgctcaccgcc
gccccccgggagatccccgaggccctgctgcagcagctgggcgagggcggcgtgctggtg
gccccggtgggcgatgaggggggcagccagaagctgatccgcatcacccgcacggccaat
ggtttcgagcaggaagtgctggagtcggtgagtttcgtacccatgctgcccgggaccatc
acgtga

DBGET integrated database retrieval system