KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1440Help
Entry
Tgr7_1440         CDS       T00840                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tgr7_1440
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tgr7_1440
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tgr7_1440
Enzymes [BR:tgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tgr7_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1536554..1537693
Genome map
AA seq 379 aa AA seqDB search
MPFRTRYTGLIDRYRDRLPVHDDTRIISLGEGNTPLIRLNNIPRIVGKEVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARAGITAFVLIPDGKIAMG
KLAQAMMHGSVVIQIKGNFDDGMRLVKEVADQAPVTIVNSINPYRLQGQKTAAFEIVEEL
GRAPDYHCLPVGNAGNITAHWIGYCEYSSASGDHVTAACTFCKGHCKYAGGAVVGNRPKM
IGYQAAGSAPFMRGAMVDDPETVATAIRIGHPQSWDSAWKVKEESGGWFDECSDAEILAA
QKLLAEKEGVFCEPASATSLAGALRDIQTGKIPEGSSIVCTLTGHGLKDPDTAIAQSTRP
LVNVEAKLDQVKRAILDNM
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccatttcgtacccgctacaccggactgatcgaccgttaccgcgaccgcctgccggtg
catgacgacacccgcatcatcagcctgggtgaaggcaacacgccgctgatccgcctgaac
aacatcccgcgcatcgtcggcaaggaagtggacatctacgtgaagtacgaggggctcaac
cccaccggctccttcaaggatcgcggcatgaccatggccgtgaccaaggcggtggaggag
ggctccaaggccatcatctgtgcctccacgggcaacacctccgcggctgccgccgcctac
gccgcccgggccggcatcaccgccttcgtgctcatccccgacggcaagatcgccatgggc
aagctggcccaggccatgatgcacggctccgtggtgatccagatcaagggcaacttcgat
gacggcatgcgcctcgtgaaggaagtggccgaccaggccccggtgaccatcgtgaattcc
atcaatccgtatcgtcttcagggccagaagaccgccgccttcgagatcgtcgaggaactg
ggtcgcgccccggactatcactgcctgcccgtgggcaacgccggcaacatcaccgcccac
tggatcggctactgcgagtacagttccgcctccggcgatcacgtcacggcggcctgcacc
ttctgcaagggccactgcaagtacgccggcggcgccgtggtgggcaaccgcccgaagatg
atcggctaccaggccgccggcagcgcgcccttcatgcgcggcgccatggtggacgacccc
gagaccgtggccaccgccatccgcatcggtcatccccagtcctgggattccgcctggaag
gtgaaggaggaatccggcggctggttcgacgaatgcagcgacgccgagatcctggctgcc
cagaaattgctggccgagaaggaaggcgtgttctgcgaacccgcctccgccacctccctg
gccggtgccctgcgcgacatccagaccggcaagatccccgagggctccagcatcgtctgc
accctcacgggtcacggcctcaaggaccccgacaccgccatcgcccagagcacccgtccg
ctggtgaacgtagaggccaagctggatcaggtgaagcgggcgatcctggataacatgtaa

DBGET integrated database retrieval system