KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1549Help
Entry
Tgr7_1549         CDS       T00840                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tgr7_1549
   00052 Galactose metabolism
    Tgr7_1549
   00500 Starch and sucrose metabolism
    Tgr7_1549
   00520 Amino sugar and nucleotide sugar metabolism
    Tgr7_1549
Enzymes [BR:tgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tgr7_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1661515..1662408
Genome map
AA seq 297 aa AA seqDB search
MHKKIRKAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAAEEAVAAGIDVLVFVTGR
NKRSIPDHFDKAYELETELEERGKEKMLAIVRNILPPHVSCVYIRQAEALGLGHAVGCAR
PVVGDEPFAVILADDLVDGQGHGGALTQMVEIYNRHGCSVLGVEEVPHEDTNKYGVVTPE
PLEDDLWRVKGIVEKPAPKDAPSNMAVVGRYILTPRIFELLENTGRGAGGEIQLTDAIAS
LLKEEQVLAHRFKGKRYDCGSKLGYLQATVEYALKHPELQDDFGAYIDELCAGRRKA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagattcgcaaggccgtgttccctgtcgccggcatgggcacccgatttctg
cccgcgaccaaggccaatcccaaggaaatgctgcccatcgtcgacaagccgctgatccag
tacgcggcggaggaggcggtggctgcgggcatcgatgtgctggtattcgtgaccggacgc
aacaaacgctccatccccgatcacttcgataaggcctacgagctggagacggaactggag
gagcgtggcaaggagaagatgctggccatcgtgcgcaacatcctgccgcctcacgtgtcc
tgtgtgtacatccgccaggccgaggccctgggcctggggcatgcggtcggctgcgcccgg
ccggtggtgggcgatgaacccttcgcggtgatcctggccgacgacctggtggatggccag
ggacacggcggcgccctgacccagatggtggagatctacaatcgccacggctgcagcgtc
ctgggcgtggaggaagtcccccacgaggacaccaacaagtacggtgtggtcacgcccgag
cccctggaagatgacctgtggcgggtgaagggcatcgtcgagaagccggcccccaaggac
gcaccctccaatatggctgtggtgggtcgatacatcctcacgccgcgcatcttcgagttg
ctggaaaacacgggccgtggcgccggtggcgagatccagctcaccgacgccatcgccagc
ctgctcaaggaagagcaggtactcgcccatcgcttcaagggcaagcgctatgactgcggc
agcaagctgggctacctgcaggccacggtggaatatgccctgaagcatccggaactgcag
gatgactttggcgcctacatcgacgagctttgtgccgggaggcgcaaggcctga

DBGET integrated database retrieval system