KEGG   Thioalkalivibrio sulfidiphilus: Tgr7_1594Help
Entry
Tgr7_1594         CDS       T00840                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tgr  Thioalkalivibrio sulfidiphilus
Pathway
tgr00260  Glycine, serine and threonine metabolism
tgr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tgr01100  Metabolic pathways
tgr01110  Biosynthesis of secondary metabolites
tgr01130  Biosynthesis of antibiotics
tgr01230  Biosynthesis of amino acids
Module
tgr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tgr7_1594
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tgr7_1594
Enzymes [BR:tgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tgr7_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL72677
JGI: Tgr7_1594
UniProt: B8GRX3
Position
complement(1710480..1711841)
Genome map
AA seq 453 aa AA seqDB search
MSDTVKYVLDEKDIPRHWYNIMADLPSPPPPVLHPATHQPVGPDDLAPLFPMAVIQQEVS
QEREIEIPEPVREVYRQWRPSPLFRARRLEKMLDTPARIYYKYEGVSPAGSHKPNTAIAQ
AFYNKQEGVKRITTETGAGQWGSSLALAGSLFGLEIEVFMVKVSFQQKPYRRSFMETFGA
KCIASPSDMTEAGRAVLREHPDSTGSLGIAISEAVERAVQRDDTKYALGSVLNHVLLHQT
VIGLEAMKQFDLAGDYPDIVIAPTGGGSNFGGITFPFLGEQLRGGRKIDLVAVEPSACPT
LTRGKYAYDFGDTAHLTPLVKMHTLGSTYVPPGFHAGGLRYHGMAPLVSHITDLGLVRPR
AYQQTECFEAGILFAKAEGIIPAPEANHGVKAAIDEALRCKEEGVSRAILFNLCGHGHFD
MQAYRDYLDGKLVDQEYDESEIAMALAGLPSVA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccgtcaaatacgtcctcgacgagaaggacattcccaggcactggtacaac
atcatggcggacctgccttccccgccgccgcccgtgctgcatcccgccacacaccagccg
gtgggtcccgacgacctggcgccgctcttccccatggccgtgatccagcaggaggtcagc
caggagcgggagatcgagatcccggagccggtacgcgaggtctatcgtcagtggcggccc
tcgcccctgttccgcgcccgtcgtctggagaagatgctcgataccccggcgcgcatctat
tacaagtacgaaggcgtcagtcctgccggttcccacaagcccaacaccgccatcgcccag
gccttctacaacaagcaggaaggcgtcaaacgcatcaccaccgagaccggtgccggtcag
tggggctcgtccctggcactggcgggttccctgttcggcctggagatcgaggtcttcatg
gtcaaggtgagcttccagcaaaagccctaccggcgttccttcatggagaccttcggcgcc
aagtgcatcgccagtccctcggacatgaccgaggcgggccgggccgtgctcagggaacac
ccggacagcaccggcagcctgggtatcgccatcagcgaggcggtggagcgcgcggtgcag
cgggacgacaccaagtacgccctgggcagcgtgctcaaccacgtgctgctgcaccagacg
gtgatcggtctggaggccatgaagcagttcgacctggccggtgactacccggacatcgtc
atcgcccccaccggcggcggcagcaacttcggtggcatcaccttccccttcctgggcgag
cagctgcgcggcggccgcaagatcgacctggtggcggtggagccctccgcctgcccgacc
ctgacccggggcaagtacgcctacgacttcggcgacaccgcgcatctcaccccgctggtg
aagatgcacaccctgggctccacctatgtgccgcccggtttccacgccggtggcctgcgc
tatcacggcatggcgcccctggtgtcacacatcacagatctcggactggtacggccccgc
gcctatcagcagaccgagtgcttcgaggcgggcatcctgttcgccaaggcggaaggcatc
atcccggcgcccgaggccaaccacggcgtgaaggcggccatcgacgaggccctgcgctgc
aaggaggaaggagtgagccgcgcgatcctgttcaacctgtgcggccatggtcacttcgac
atgcaggcctatcgcgattacctggacggcaagctggtggatcaggaatacgacgagtcc
gagatcgccatggcactggctgggctgccttcggtggcgtaa

DBGET integrated database retrieval system