KEGG   Thioalkalivibrio sulfidophilus: Tgr7_2235Help
Entry
Tgr7_2235         CDS       T00840                                 

Gene name
ruvA
Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tgr  Thioalkalivibrio sulfidophilus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tgr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2362553..2363158)
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGELVSKQPPFLLLDVQGVGYEIEAPLSTFYDLPEPGGQVTLHTHLHVREDAHVL
YGFASESERALFRSLIKVTGVGAKMALAILSGMTASEFSRCVMDGDVASLVRLPGIGRKT
AERLVVEMRDRLGSLPAAVTLTGGKPAAAAARAPDPVSDAVSALVSLGYKPQEASRLISA
VEGEAERSEDLIRLALKATLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcgcctgcgtggcgagttggtgagcaagcagccccccttcctgctcctggac
gtgcagggggtgggctacgagatcgaggcgccgctttccaccttctacgacctgcccgag
ccgggcgggcaggtcaccctgcacacccacctgcacgtgcgcgaggacgcccacgtgctc
tacggcttcgccagtgagtcggagcgcgccctgttccgcagcctgatcaaggtcaccggc
gtgggcgccaagatggcactggccatcctctcgggcatgaccgccagcgagttctcccgc
tgtgtcatggatggagacgtggcctccctggtgcgcctgccgggcatcggccgcaagacc
gccgagcggctggtggtggagatgcgtgaccgcctgggcagtctgcccgccgcggtcacg
ctgaccggcggcaagccggccgccgcggccgccagggccccggacccggtcagtgacgcc
gtctccgccctggtatccctgggctacaagccccaggaggccagtcgcctgatcagcgcc
gtggagggggaggcggagcgttccgaggacctgatccggctggccttgaaggcaacgctc
aaatag

DBGET integrated database retrieval system